KEGG   Mus musculus (mouse): 15557Help
Entry
15557             CDS       T01002                                 

Gene name
Htr1f, Htr1eb
Definition
(RefSeq) 5-hydroxytryptamine (serotonin) receptor 1F
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04726  Serotonergic synapse
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    15557 (Htr1f)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15557 (Htr1f)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    15557 (Htr1f)
  09157 Sensory system
   04742 Taste transduction
    15557 (Htr1f)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    15557 (Htr1f)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    15557 (Htr1f)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx DUF2207 Glycoprotein_G
Motif
Other DBs
NCBI-GeneID: 15557
NCBI-ProteinID: NP_032336
MGI: 99842
Ensembl: ENSMUSG00000050783
UniProt: Q02284 Q543V2
Position
16 C1.3; 16 37.1 cM
AA seq 366 aa AA seqDB search
MDFLNASDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY
LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVLCDIWLSVDIICCTCSILHLSAIALD
RYRAITDAVEYARKRTPRHAGIMITIVWVISVFISMPPLFWRHQGTSRDDECVIKHDHIV
STIYSTFGAFYIPLVLILILYYKIYRAARTLYHKRQASRMIKEELNGQVFLESGEKSIKL
VSTSYMLEKSLSDPSTDFDRIHSTVKSPRSELKHEKSWRRQKISGTRERKAATTLGLILG
AFVICWLPFFVKELVVNVCEKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQK
LVRCRY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggattttttaaacgcatcagaccaaaacttgacctctgaggaactgttaaaccgaatg
ccatccaaaattctggtatccctcactctgtctgggctggcattgatgacaaccaccatc
aactccctcgtgatcgctgcgatcattgtgactcggaagctgcaccacccagccaactat
ttaatttgttccttggcagttacagattttcttgtagctgtcctggtgatgcccttcagt
attgtgtacattgtgagagagagctggattatgggacaagtactctgtgacatttggctg
agtgtcgacatcatctgttgtacgtgttccatcttgcatctgtcggctatagccttggat
aggtaccgcgccatcacagatgcagttgaatacgccaggaagaggactcccaggcatgcc
ggcatcatgatcacgatcgtgtgggttatatctgtgttcatctctatgcctcctctcttc
tggaggcaccaaggaactagccgtgatgatgagtgtgtcatcaaacatgaccacattgtt
tccacaatttactccacgtttggagctttctacatcccgcttgtattgatattgatcctc
tactacaaaatatacagagcagcaaggacactgtaccacaagagacaagcgagtcggatg
ataaaggaggagctgaacggtcaagtcttcttggagagcggtgagaagagcattaaactg
gtctccacatcctacatgttagaaaaatccttgtccgatccatcaacggactttgataga
attcacagcaccgtgaaaagtcccagatcggaactgaagcatgagaaatcttggagaaga
cagaaaatctcaggcaccagagaacgcaaagcagccactaccctgggattgatcttgggt
gcatttgtaatatgttggctgcccttttttgtaaaagaattggttgttaatgtctgtgaa
aaatgtaaaatttctgaagaaatgtcaaactttttggcatggcttggttacctgaattcc
cttataaatccactgatttataccatctttaatgaagacttcaagaaagctttccaaaaa
cttgtacgatgccgatattag

DBGET integrated database retrieval system