KEGG   Mus musculus (mouse): 15558
Entry
15558             CDS       T01002                                 

Symbol
Htr2a, 5-HT-2, 5-HT-2A, E030013E04, Htr-2, Htr2
Name
(RefSeq) 5-hydroxytryptamine (serotonin) receptor 2A
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04540  Gap junction
mmu04726  Serotonergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    15558 (Htr2a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15558 (Htr2a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    15558 (Htr2a)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    15558 (Htr2a)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    15558 (Htr2a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    15558 (Htr2a)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    15558 (Htr2a)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 15558
NCBI-ProteinID: NP_766400
MGI: 109521
Ensembl: ENSMUSG00000034997
UniProt: P35363 Q543D4
Position
14 D3; 14 39.37 cM
AA seq 471 aa
MEILCEDNISLSSIPNSLMQLGDDSRLYPNDFNSRDANTSEASNWTIDAENRTNLSCEGY
LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLSSFSFLPQSSLSSEKLFQRSIH
REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPTLAYK
SSQLQVGQKKNSQEDAEPTANDCSMVTLGNQHSEEMCTDNIETVNEKVSCV
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggaaattctctgtgaagacaatatctccctgagctcaattccaaactccttaatgcaa
ttaggtgacgactcgaggctctaccctaatgacttcaactccagggatgctaacacttcc
gaagcctcgaactggacaattgatgctgaaaacagaaccaacctctcctgcgaagggtac
ctcccaccgacatgcctctccattcttcatctccaggaaaaaaactggtctgctttattg
acaactgtcgtgattattctcaccattgcgggaaacatactggtcatcatggcagtgtcc
ctagagaaaaagctgcagaatgccaccaactatttcctgatgtcacttgccatagctgat
atgctgctgggtttccttgtcatgcccgtgtccatgttaaccatcctgtatgggtaccgg
tggcctttgcccagcaagctctgtgccgtctggatttacctggatgtgctcttctccacg
gcgtccatcatgcacctctgcgccatctccctggaccgctacgtggctatccagaacccc
attcaccatagccgcttcaactccagaaccaaagccttcctgaaaatcattgcggtgtgg
accatatccgtaggtatatccatgccaatcccagtcttcgggctacaggatgattcgaag
gtctttaaggaagggagctgcctgctcgccgatgacaactttgtcctcataggctctttt
gtggcatttttcatccccctaaccatcatggtgatcacctacttcctgactatcaagtca
cttcagaaagaagccaccttgtgtgtgagtgacctcagcactcgggccaaattatcctcc
ttcagcttcctccctcagagttctctgtcatcagaaaagctcttccagcggtccatccac
agagagccaggctcctacgcaggccgaaggacgatgcagtccatcagcaacgagcaaaaa
gcatgcaaggtgctgggcatcgtgttctttctgtttgttgtaatgtggtgcccattcttc
atcaccaatatcatggccgtcatctgcaaagaatcctgcaatgaaaatgtcattggagcc
ctgctcaatgtgtttgtctggattggttatctctcctcagccgtcaacccactggtatat
acgttgttcaataaaacttataggtccgccttctcacggtacattcagtgccagtacaag
gagaacagaaagccgctgcagttaattttagtgaacactataccaacattggcctacaag
tctagtcagctccaggtgggacaaaaaaagaactcacaggaagatgctgagccgacagct
aatgactgctccatggttacactagggaaccaacactcggaagagatgtgtacagacaat
attgaaaccgtgaatgaaaaggttagctgtgtgtga

DBGET integrated database retrieval system