KEGG   Mus musculus (mouse): 15560
Entry
15560             CDS       T01002                                 

Gene name
Htr2c, 5-HT2C, 5-HT2cR, 5-HTR2C, 5HT1c, Htr1c, SR1
Definition
(RefSeq) 5-hydroxytryptamine (serotonin) receptor 2C
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04540  Gap junction
mmu04726  Serotonergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    15560 (Htr2c)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15560 (Htr2c)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    15560 (Htr2c)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    15560 (Htr2c)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    15560 (Htr2c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    15560 (Htr2c)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    15560 (Htr2c)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 DUF1385 UPF0182 DUF3169 EVC2_like
Other DBs
NCBI-GeneID: 15560
NCBI-ProteinID: NP_032338
MGI: 96281
Ensembl: ENSMUSG00000041380
Vega: OTTMUSG00000018943
UniProt: P34968 Q8BZI5
Position
X F2; X 68.46 cM
AA seq 459 aa
MVNLGTAVRSLLVHLIGLLVWQFDISISPVAAIVTDTFNSSDGGRLFQFPDGVQNWPALS
IVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYV
WPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVW
AISIGVSVPIPVIGLRDESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIY
VLRRQTLMLLRGHTEEELRNISLNFLKCCCKKGDEEENAPNPNPDQKPRRKKKEKRPRGT
MQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGYV
CSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPPVRQIPRVAATALSGRELNVNIYRHT
NERVVRKANDTEPGIEMQVENLELPVNPSNVVSERISSV
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggtgaacctgggcactgcggtgcgctcactccttgtgcacctaattggcctattggtt
tggcagttcgatatttccataagtccagtagcagctatagtaactgacacttttaattcc
tccgatggtggacgcttgtttcaattcccggacggggtacaaaactggccagcactttca
atagtcgtgattataatcatgacaatagggggcaacattctcgttatcatggcagtaagc
atggagaagaaactgcacaatgctaccaattatttcttaatgtccctagccattgctgat
atgctggtgggactacttgtcatgcccctgtctctgcttgcaattctttatgattatgtc
tggcctttacctagatatttgtgccccgtctggatttcactagatgtgctattttcaact
gcgtccatcatgcacctctgcgccatatcgctggaccggtatgtagcaatacgtaatcct
attgagcatagccggttcaattcgcggactaaggccatcatgaagattgccatcgtttgg
gcaatatcaataggagtttcagttcctatccctgtgattggactgagggacgaaagcaaa
gtgttcgtgaataatactacctgcgtgctcaatgacccgaacttcgttctcatcgggtcc
ttcgtggcattcttcatcccgttgacaattatggtgatcacctacttcttaacgatctac
gtcctacgccgtcaaaccctgatgttacttcgaggtcacaccgaggaggaactgcgtaat
atcagcctgaactttctaaagtgctgctgcaagaagggtgatgaggaagagaacgctccc
aaccccaatccagatcagaagccacgtcgaaagaagaaagaaaagcggcctagaggcacc
atgcaagctatcaacaatgagaagaaagcttccaaagtccttggcattgtattctttgtg
tttctgatcatgtggtgcccgtttttcatcaccaatatcctgtcggtgctttgtgggaag
gcctgtaaccaaaagctaatggagaaacttctcaatgtgtttgtttggattggctatgtg
tgttcaggcatcaatcctctggtgtacactctcttcaacaaaatttaccgaagggctttc
tctaaatatttgcgctgcgattataagccagacaaaaagcctcctgttcgacagattcct
agggttgctgccactgctttgtctgggagggagctcaatgttaacatttatcggcatacc
aatgaacgtgtagttaggaaagctaatgacacagagcctggcatagagatgcaggtagag
aatttagagctgccggtcaatccctctaatgtggtcagcgagaggattagtagtgtgtaa

DBGET integrated database retrieval system