KEGG   Mus musculus (mouse): 15561Help
Entry
15561             CDS       T01002                                 

Gene name
Htr3a, 5-HT3
Definition
(RefSeq) 5-hydroxytryptamine (serotonin) receptor 3A
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04726  Serotonergic synapse
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    15561 (Htr3a)
  09157 Sensory system
   04742 Taste transduction
    15561 (Htr3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    15561 (Htr3a)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   15561 (Htr3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 15561
NCBI-ProteinID: NP_038589
MGI: 96282
Ensembl: ENSMUSG00000032269
Vega: OTTMUSG00000063011
UniProt: P23979 Q8K1F4 E9QLC0
Structure
PDB: 

Position
9; 9 A5.3
AA seq 489 aa AA seqDB search
MRLCIPQVLLALFLSMLTAPGEGSRRRATQARDTTQPALLRLSDHLLANYKKGVRPVRDW
RKPTTVSIDVIMYAILNVDEKNQVLTTYIWYRQYWTDEFLQWTPEDFDNVTKLSIPTDSI
WVPDILINEFVDVGKSPNIPYVYVHHRGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTF
TSWLHTIQDINITLWRSPEEVRSDKSIFINQGEWELLEVFPQFKEFSIDISNSYAEMKFY
VIIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTL
PATAIGTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQRPVPDWLRHLVLDRIAWIL
CLGEQPMAHRPPATFQANKTDDCSGSDLLPAMGNHCSHVGGPQDLEKTPRGRGSPLPPPR
EASLAVRGLLQELSSIRHFLEKRDEMREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLV
TLWSIWHYS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcggctctgcatcccgcaggtgctgttggccttgttcctttccatgctgacagccccg
ggagaaggcagccggaggagggccacccaggcccgagataccacccagcctgctctacta
aggctgtcagaccacctcctggctaactacaagaagggggtgcggcctgtgcgggactgg
aggaagcctactactgtctccattgatgtcatcatgtatgccatcctcaacgtggatgag
aagaaccaggttctgaccacctacatatggtaccggcagtactggactgatgagtttctg
cagtggactcctgaggacttcgacaatgtcaccaaattgtccatccccacagacagcatc
tgggtccctgacatcctcatcaatgagtttgtggacgtggggaagtctccgaacattcct
tatgtgtacgtgcatcatcgaggtgaagttcagaactacaagcccttgcaattggtgacc
gcctgtagccttgacatctacaacttcccctttgatgtgcagaactgctctctgactttc
accagctggctgcacaccatccaggacatcaacattaccctgtggcgatcaccggaagaa
gtgaggtctgacaagagcatcttcataaatcagggcgagtgggagctgctggaggtgttc
ccccagttcaaggagttcagcatagatatcagtaacagctatgcagaaatgaagttctac
gtgatcatccgccggaggcctttattctacgcagtcagcctcttgctgcccagtatcttc
ctcatggtcgtggacattgtgggcttttgcctgcccccggacagcggtgagagagtctct
ttcaagatcacactccttctgggatactcagtcttcctcatcatcgtgtcagacacactg
ccagcaacggccatcggtacccccctcattggtgtctattttgtggtgtgcatggctctg
ctagtgataagcctcgctgagaccatcttcattgtgcggctggtgcataagcaggaccta
cagcggccagtacctgactggctgaggcacctggtcctagacagaatagcctggatactc
tgcctaggggagcagcctatggcccatagacccccagccaccttccaagccaacaagact
gatgactgctcaggttctgatcttcttccagccatgggaaaccactgcagccatgttgga
ggacctcaggacttggagaagaccccaaggggcagaggtagccctcttccaccaccaagg
gaggcctcgctggctgtgcgcggtctcttgcaagagctatcctccatccgccacttcctg
gagaagcgggatgagatgcgggaggtggcaagggactggctgcgggtgggatacgtgctg
gacaggctgctgttccgcatctacctgctggctgtgctcgcttacagcatcaccctggtc
actctctggtccatttggcattattcttga

DBGET integrated database retrieval system