KEGG   Mus musculus (mouse): 15563Help
Entry
15563             CDS       T01002                                 

Gene name
Htr5a, Htr5
Definition
(RefSeq) 5-hydroxytryptamine (serotonin) receptor 5A
  KO
K04161  5-hydroxytryptamine receptor 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    15563 (Htr5a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15563 (Htr5a)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    15563 (Htr5a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    15563 (Htr5a)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    15563 (Htr5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srv DUF2208
Motif
Other DBs
NCBI-GeneID: 15563
NCBI-ProteinID: NP_032340
MGI: 96283
Ensembl: ENSMUSG00000039106
Vega: OTTMUSG00000054148
UniProt: P30966 Q3UVG4
Position
5 B1; 5 13.24 cM
AA seq 357 aa AA seqDB search
MDLPVNLTSFSLSTPSSLEPNRSLDTEVLRPSRPFLSAFRVLVLTLLGFLAAATFTWNLL
VLATILKVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHLEYTLRTRKRVSNVMILLTWALSTVISLAPLLFG
WGETYSEPSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWKIYRAAKFRMGSRKTNSVS
PVPEAVEVKNATQHPQMVFTVRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVLCWFP
FFVTELISPLCSWDVPAIWKSIFLWLGYSNSFFNPLIYTAFNRSYSSAFKVFFSKQQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcctgtaaacttgacctccttttctctctctactccctcctctttggaacct
aaccgcagcttggacacggaagtcctgcgccctagtcggccttttctctcagctttccga
gtgctagtcctgactttgttgggctttctagctgcggccacattcacttggaacctgctg
gtgctggctaccatcctcaaggtacgcaccttccaccgagtaccacacaacctggtagct
tccatggccatctcggatgtgctagtggctgtgctggttatgccactgagcctggtacat
gagctgtctgggcgccgctggcagctgggccggcgtctatgccagctgtggatcgcatgt
gacgtgctctgctgtactgccagcatctggaatgtgacagcaatagctctggaccgctac
tggtcaatcacgcgccacctggagtacacactccgtacccgcaagcgtgtctccaatgtg
atgatcctgctcacctgggcactctccactgtcatctctctggctccactgctatttggc
tggggagagacttattctgagcccagtgaggaatgccaagtcagtcgcgagccttcctac
accgtgttctccaccgtgggtgccttctacctgccgctgtgcgtggtgctctttgtgtac
tggaaaatttacagggcggcgaaattccgcatgggctccaggaagaccaacagcgtctcc
cccgtacccgaagctgtggaggtgaagaatgctacacaacatccccagatggtgttcacg
gtccgccatgccaccgtcaccttccagacagaaggggatacgtggagggagcagaaggag
caaagggcagccctcatggtgggcatcctcatcggagtgtttgtgctctgctggttccct
ttcttcgtcacagagctcatcagtcccctgtgttcctgggacgtccctgccatctggaag
agcatcttcctgtggttgggctattctaattccttcttcaacccactcatctacacagca
ttcaacaggagctacagcagtgctttcaaggtcttcttctccaagcaacaatga

DBGET integrated database retrieval system