KEGG   Mus musculus (mouse): 15565Help
Entry
15565             CDS       T01002                                 

Gene name
Htr6, 5-HT6
Definition
(RefSeq) 5-hydroxytryptamine (serotonin) receptor 6
  KO
K04162  5-hydroxytryptamine receptor 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    15565 (Htr6)
   04024 cAMP signaling pathway
    15565 (Htr6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15565 (Htr6)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    15565 (Htr6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    15565 (Htr6)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    15565 (Htr6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 15565
NCBI-ProteinID: NP_067333
MGI: 1196627
Ensembl: ENSMUSG00000028747
Vega: OTTMUSG00000009899
UniProt: Q9R1C8 Q14AW8
Position
4 D3; 4 70.57 cM
AA seq 440 aa AA seqDB search
MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTSAPGQC
RLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTATAGQALETLQ
VPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFVTWLPFFVASIAQAVCDCIS
PGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCVHCPPEHRASPASPSMWTSHS
GARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLLLPGEATRDPPPPTRAPTVVNF
FVTDSVEPEIRQHPLGSPMN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggttccagagcccggccctgtcaacagtagcaccccagcctggggccccgggccaccg
ccagccccagggggcagcggctgggtggccgctgcgctgtgcgtggtcatcgtgctgacg
gcagccgccaattcgctgctgatcgcgctcatctgcacgcagcccgcgctgcgcaacacg
tctaacttcttcctggtgtcgctcttcacgtcggacctgatggtgggattggtggtgatg
cccccagccatgctgaacgcgctgtatgggcgctgggtgctagctcgcggcctctgtctg
ctttggaccgccttcgacgtgatgtgctgcagcgcctccattctcaacctctgcctcatc
agcctggaccgctacctgctcatcctctcgccgctgcgctacaagctgcgcatgacagcc
ccgcgtgccctggcgctcatcctgggtgcctggagcctcgccgcgctggcctccttcctg
cccctcttgctgggctggcatgaactgggcaaagctcgaacatctgccccgggccagtgc
cgcctattggccagcctgccttatgtcctcgtggcgtccggcgtcacctttttcctgcct
tcgggtgccatctgcttcacctactgcaggatcttgctggctgcccgcaagcaggcggtg
caagtggcctcgctcaccacgggcacggctacggctggccaggccttggaaaccttgcag
gtgcccaggacaccacgcccagggatggagtctgctgacagtaggcgtctgaccaccaag
catagcaggaaggccttgaaggccagcctgaccctcggcatcctgctgagcatgttcttt
gtcacctggctgcccttctttgtggccagcatagctcaggccgtatgtgactgcatctct
ccaggtctcttcgatgtcctcacatggctgggatactgtaatagcaccatgaaccctatc
atctatcccctcttcatgcgggacttcaagagggccctgggcaggttcgtgccgtgtgtc
cactgtcccccggagcaccgggccagccccgcctccccctccatgtggacctctcacagt
ggtgccaggccaggcctcagcctgcagcaggtgctgcccctgcctctgccacccaactca
gattcagactcagcttcagggggcacctcgggcctgcagctcacagcccagcttttgctg
cctggagaggcgacccgggaccccccgccacccaccagggcccctactgtggtcaacttc
ttcgtcacagactctgtggagcctgagatacggcagcatccacttggttcccccatgaac
tga

DBGET integrated database retrieval system