KEGG   Mus musculus (mouse): 15566Help
Entry
15566             CDS       T01002                                 

Gene name
Htr7, 5-HT-X, 5-HT7
Definition
(RefSeq) 5-hydroxytryptamine (serotonin) receptor 7
  KO
K04163  5-hydroxytryptamine receptor 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    15566 (Htr7)
   04020 Calcium signaling pathway
    15566 (Htr7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15566 (Htr7)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    15566 (Htr7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    15566 (Htr7)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    15566 (Htr7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 15566
NCBI-ProteinID: NP_032341
MGI: 99841
Ensembl: ENSMUSG00000024798
Vega: OTTMUSG00000035906
UniProt: P32304
Position
19 C2; 19 30.3 cM
AA seq 448 aa AA seqDB search
MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWMPHLLSGFPEVTASPA
PTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSN
YLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVIS
IDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDF
GYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFSGFPRVQPESVISLNGVVKLQK
EVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTS
CSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE
ALKLAERPERSEFVLQNCDHCGKKGHDT
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgttaacagcagcggccgccccgacctctacggccatctccgctctctcatc
ctgccggaggtggggcgcaggctgcaggacctgagccccgacggtggcgcccactcggtg
gtgagctcctggatgccgcacctgctgagcggcttcccagaggtgacagctagcccggcg
cccacctgggacgcgcccccggacaatgtctccggctgcggggagcagatcaactatggc
agagtcgagaaagttgtgatcggctccatcctgacgctcatcacgctgctgacgatcgcg
ggcaactgcctggtggtgatctcggtgtgctttgtcaagaagctccgccagccctccaac
tacctgattgtgtccctggcgctggctgacctctcggtggccgtggcggtcatgcctttc
gttagtgtcacggacctcatcgggggcaagtggatcttcggccacttcttctgcaacgtc
ttcatcgccatggacgtcatgtgctgcacggcctcgatcatgaccctgtgcgtgatcagc
atcgacaggtaccttgggatcaccaggcccctcacgtaccccgtgaggcagaatgggaaa
tgtatggccaaaatgattctgtcggtctggcttctctctgcctccatcaccttacctcct
ctcttcggatgggctcagaatgtgaacgatgacaaagtgtgcttgatcagccaggatttt
ggctacacgatctactccaccgcagtggcgttttatatccccatgtcggtcatgctgttc
atgtactatcagatttacaaggccgccaggaagagcgcagccaaacacaagttctcaggc
ttcccacgcgtgcagccggagagcgtcatctccctgaatggcgtggtgaaactccagaag
gaggtggaagagtgtgcgaacctttcgagactgctcaaacacgaaaggaaaaacatttcc
atcttcaagagggaacagaaagcagccactaccttggggatcatcgtgggagccttcacg
gtgtgctggctgccgtttttcctcttgtccacagcaaggccctttatctgtggcacctcc
tgtagctgcatcccgctgtgggtggagaggacatgtctgtggctgggctatgcaaactct
ctcattaacccttttatatatgccttcttcaaccgggacctgaggaccacctatcgtagc
ctactccagtgccagtaccggaatatcaaccggaagctctctgctgcaggcatgcacgaa
gccctgaaacttgctgagaggcctgagagaagcgagtttgtgctacaaaactgtgaccac
tgtgggaaaaaaggtcatgatacatga

DBGET integrated database retrieval system