KEGG   Mus musculus (house mouse): 15574
Entry
15574             CDS       T01002                                 
Symbol
Hus1
Name
(RefSeq) HUS1 checkpoint clamp component
  KO
K10903  HUS1 checkpoint protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    15574 (Hus1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    15574 (Hus1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Rad9-Hus1-Rad1 complex
    15574 (Hus1)
SSDB
Motif
Pfam: Hus1 DUF1828
Other DBs
NCBI-GeneID: 15574
NCBI-ProteinID: NP_001290461
MGI: 1277962
Ensembl: ENSMUSG00000020413
Vega: OTTMUSG00000005146
UniProt: Q8BQY8
Position
11:complement(8943137..8961240)
AA seq 280 aa
MKFRAKIVDLACLNHFTRVSNMIAKLAKTCTLRISPEKLNFILCDKLASGGVSMWCELEQ
ENFFSEFQMEGVSEENNEIYLELTSENLSRALKTAQNSRALKIKLTNKHFPCLTVSVELV
SSSSSSRIVVHDIPIKVLPRRLWKDLQEPSIPDCDVSICLPALKMMKSVVEKMRNISNQL
VIEANLKGELNLKIETELVCVTTHFKDLENPLLPSDSVSQNRHPEDMAKVHIDIKKLLQF
LAGQQVTPTKAVCNIVNNRTVHFDLLLEDVSLQYFIPALS
NT seq 843 nt   +upstreamnt  +downstreamnt
atgaagtttcgcgccaagatcgtggacctggcttgtctgaatcatttcacacgagtcagt
aacatgatagccaagcttgccaaaacctgcaccctccgcatcagcccggagaagctgaac
ttcatcctgtgcgacaagctggccagtggaggcgtgagcatgtggtgtgagctggagcag
gagaacttttttagtgaatttcaaatggaaggagtctctgaagaaaacaacgagatttat
ttagaattaacgtcggaaaacttatctcgagccttgaaaactgcccagaactccagagcc
ttgaaaatcaagctgactaacaaacactttccctgtcttaccgtgtctgtagagctggtg
tcttcatcgagcagcagcagaatcgtggtgcatgatatccccataaaggttcttccgaga
agactgtggaaggacttacaagaaccctccatcccagactgtgacgtcagtatttgctta
ccagccttgaagatgatgaagagtgttgtggaaaaaatgagaaacatcagcaatcagctt
gtgattgaagcaaacctaaagggagaattaaacctaaagatagaaactgagttagtgtgt
gtgactactcattttaaggatcttgaaaaccctctattaccctctgacagtgtctctcaa
aacagacacccagaagacatggccaaggtgcacattgacataaagaaactcctccagttt
cttgccggacagcaagtgactcccaccaaggcagtgtgcaatattgtgaataacagaact
gttcattttgatttgctcctggaagacgtctcccttcagtatttcatcccagccttgtcc
tag

DBGET integrated database retrieval system