KEGG   Mus musculus (house mouse): 15586
Entry
15586             CDS       T01002                                 
Symbol
Hyal1, Fus2, Hya1, Hyal-1, Nat6
Name
(RefSeq) hyaluronoglucosaminidase 1
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00531  Glycosaminoglycan degradation
mmu01100  Metabolic pathways
mmu04142  Lysosome
Module
mmu_M00076  Dermatan sulfate degradation
mmu_M00077  Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    15586 (Hyal1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    15586 (Hyal1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:mmu02042]
    15586 (Hyal1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    15586 (Hyal1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    15586 (Hyal1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     15586 (Hyal1)
Bacterial toxins [BR:mmu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   15586 (Hyal1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Enzymes
   15586 (Hyal1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Enzymes
  15586 (Hyal1)
SSDB
Motif
Pfam: Glyco_hydro_56
Other DBs
NCBI-GeneID: 15586
NCBI-ProteinID: NP_032343
MGI: 96298
Ensembl: ENSMUSG00000010051
UniProt: Q91ZJ9
Position
9:107454149..107458898
AA seq 449 aa
MKPFSPEVSPGSSPATAGHLLRISTLFLTLLELAQVCRGSVVSNRPFITVWNGDTHWCLT
EYGVDVDVSVFDVVANKEQSFQGSNMTIFYREELGTYPYYTPTGEPVFGGLPQNASLVTH
LAHTFQDIKAAMPEPDFSGLAVIDWEAWRPRWAFNWDSKDIYRQRSMELVQAEHPDWPET
LVEAAAKNQFQEAAEAWMAGTLQLGQVLRPRGLWGYYGFPDCYNNDFLSLNYTGQCPVFV
RDQNDQLGWLWNQSYALYPSIYLPAALMGTEKSQMYVRHRVQEALRVAIVSRDPHVPVMP
YVQIFYEMTDYLLPLEELEHSLGESAAQGVAGAVLWLSSDKTSTKESCQAIKAYMDSTLG
PFIVNVTSAALLCSEALCSGHGRCVRHPSYPEALLTLNPASFSIELTHDGRPPSLKGTLS
LKDRAQMAMKFRCRCYRGWRGKWCDKRGM
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaagcccttcagtcctgaggtttccccaggctcatcccctgccaccgcaggccacctg
cttcgcatctctactctcttcctgactttgctcgagttggcccaagtctgcagaggttcc
gtggtatccaaccggccattcatcactgtttggaatggagacactcattggtgcctgacg
gagtatggagtggatgtggatgtcagtgtcttcgatgtggttgccaacaaggagcagagt
ttccaaggctctaacatgacaattttctacagagaggaattgggcacctacccctactat
acacccacaggggaacccgtatttggtggtctgccccagaatgccagcctggttacccac
cttgctcacacattccaggacatcaaggctgccatgcctgaacctgacttctcaggactg
gcagtcattgattgggaggcttggcgcccacggtgggccttcaactgggacagcaaggac
atttatcggcagcgctcaatggaactggtccaggcagagcaccctgattggccagaaact
ttagtggaggcagcagccaaaaaccagttccaggaagctgcagaggcctggatggcaggc
accctccaactggggcaggtactgcgtccccgtggcctctggggctactatggcttccct
gactgctacaacaacgactttctaagtctcaactacacaggccagtgcccagtattcgtc
cgtgatcagaacgaccagctagggtggttgtggaaccagagctatgccctttaccccagt
atttatttgcctgcagcactgatgggcacagagaagtcacagatgtacgttcgacaccgt
gtgcaagaggcgctccgtgtggctatagtttccagagacccccatgtgcccgtaatgccc
tacgtccagatcttctatgaaatgacagattatcttctgcccctggaggaactggagcac
agcctgggggagagtgcagcccagggagtggcaggagcagtgctctggctaagctcagac
aaaacaagtaccaaggaatcatgccaggccattaaagcatacatggattccacacttggg
cccttcatcgtgaacgtgaccagtgcagctcttttgtgcagcgaagctctgtgttccggc
catggtcgctgtgtccgccatccaagttatcctgaggctctcctcaccctcaaccctgcc
agtttctccattgagctaacacatgatggcaggcccccgagcctcaagggtaccctctca
cttaaggaccgggcgcagatggctatgaaattcaggtgccgatgctaccgtggatggaga
ggcaagtggtgtgacaagcggggtatgtga

DBGET integrated database retrieval system