KEGG   Mus musculus (mouse): 15874
Entry
15874             CDS       T01002                                 

Gene name
Iapp, DAP, am
Definition
(RefSeq) islet amyloid polypeptide
  KO
K08039  islet amyloid polypeptide
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15874 (Iapp)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    15874 (Iapp)
SSDB
Motif
Pfam: Calc_CGRP_IAPP
Other DBs
NCBI-GeneID: 15874
NCBI-ProteinID: NP_034621
MGI: 96382
Ensembl: ENSMUSG00000041681
Vega: OTTMUSG00000024215
UniProt: P12968
Position
6 G2; 6 73.81 cM
AA seq 93 aa
MMCISKLPAVLLILSVALNHLRATPVRSGSNPQMDKRKCNTATCATQRLANFLVRSSNNL
GPVLPPTNVGSNTYGKRNAAGDPNRESLDFLLV
NT seq 282 nt   +upstreamnt  +downstreamnt
atgatgtgcatctccaaactgccagctgtcctcctcatcctctctgtggcactgaaccac
ttgagagctacacctgtcagaagtggtagcaaccctcagatggacaaacggaagtgcaac
acggccacgtgtgccacacaacgcctggcaaactttttggttcgttccagcaacaacctt
ggtccagtcctcccaccaaccaacgtgggatcgaatacatatggcaagaggaatgcggca
ggggatccaaatagggaatccttggatttcttactcgtttaa

DBGET integrated database retrieval system