KEGG   Mus musculus (mouse): 15891
Entry
15891             CDS       T01002                                 

Gene name
Ibsp, B, BSP, BSP_II, BSPII, Bs, Bsp2
Definition
(RefSeq) integrin binding sialoprotein
  KO
K06253  integrin binding sialoprotein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    15891 (Ibsp)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    15891 (Ibsp)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    15891 (Ibsp)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    15891 (Ibsp)
SSDB
Motif
Pfam: BSP_II Cnd2
Other DBs
NCBI-GeneID: 15891
NCBI-ProteinID: NP_032344
MGI: 96389
Ensembl: ENSMUSG00000029306
Vega: OTTMUSG00000021399
UniProt: Q61711
Position
5 E5; 5 50.68 cM
AA seq 324 aa
MKTALILLSILGMACAFSMKNFHRRIKAEDSEENGVFKYRPRYFLYKHAYFYPPLKRFPV
QGGSDSSEENGDGDSSEEEGEEEETSNEEENNEDSEGNEDQEAEAENSTLSTLSGVTASY
GAETTPQAQTFELAALQLPKKAGDAESRAPKVKESDEEEEEEEEEEENENEEAEVDENEL
AVNGTSTNSTEVDGGNGSSGGDNGEEAEAEEASVTEAGAEGTTGGRELTSVGTQTAVLLN
GFQQTTPPPEAYGTTSPPIRKSSTVEYGGEYEQTGNEYNNEYEVYDNENGEPRGDTYRAY
EDEYSYYKGHGYEGYEGQNYYYHQ
NT seq 975 nt   +upstreamnt  +downstreamnt
atgaagactgctttaattttgctcagcattttgggaatggcctgtgctttctcgatgaaa
aatttccatcgaagaatcaaagcagaggattctgaagaaaacggggtctttaagtaccgg
ccacgctactttctttataagcatgcctacttttatcctcctctgaaacggtttccagtc
cagggaggcagtgactcttcagaagaaaatggagacggcgatagttccgaagaggagggg
gaggaagaggagacttcaaacgaagaggaaaacaatgaagattctgaggggaatgaagac
caggaggcggaggcagagaactccacactttccacactctcgggtgtaacagctagctac
ggagcagagaccacaccccaagcacagacttttgagttagcggcactccaactgcccaag
aaggctggagatgcagaaagcagggctccaaaagtgaaggaaagcgacgaggaagaagaa
gaagaagaggaagaggaagaaaatgagaacgaagaagcagaagtggatgaaaacgagctg
gcggtcaacggcaccagcaccaactccacggaggtggatggcgggaatggcagcagcgga
ggagacaacggagaagaagccgaagcagaggaggcaagcgtcactgaagcaggtgcagaa
ggaaccacagggggcagggaactgaccagtgttggcacccagacagctgtccttctgaac
gggtttcagcagacaaccccaccgcccgaagcctatgggaccacctcgccaccgatcaga
aaaagcagcaccgttgagtatgggggagaatacgaacaaacaggcaacgaatacaacaat
gagtatgaagtctatgacaacgagaacggggagcctcgtggcgacacttaccgagcttat
gaggatgaatacagctactacaaggggcatggctatgaaggctacgagggtcagaattat
tactaccatcagtga

DBGET integrated database retrieval system