KEGG   Mus musculus (mouse): 15896
Entry
15896             CDS       T01002                                 

Symbol
Icam2, CD102, Icam, Icam-2, Ly-60
Name
(RefSeq) intercellular adhesion molecule 2
  KO
K06523  intercellular adhesion molecule 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15896 (Icam2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15896 (Icam2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    15896 (Icam2)
   04091 Lectins [BR:mmu04091]
    15896 (Icam2)
CD molecules [BR:mmu04090]
 Proteins
  15896 (Icam2)
Lectins [BR:mmu04091]
 I-type lectins (Siglecs)
  15896 (Icam2)
SSDB
Motif
Pfam: ICAM_N Ig_2 ig Adhes-Ig_like Ig_3 DUF3377 DuoxA
Other DBs
NCBI-GeneID: 15896
NCBI-ProteinID: NP_034624
MGI: 96394
Ensembl: ENSMUSG00000001029
Vega: OTTMUSG00000003420
UniProt: P35330
Position
11 E1; 11 69.09 cM
AA seq 277 aa
MSSFACWSLSLLILFYSPGSGEKAFEVYIWSEKQIVEATESWKINCSTNCAAPDMGGLET
PTNKIMLEEHPQGKWKQFLVSNVSKDTVFFCHFTCSGKQHSESLNIRVYQPPAQVTLKLQ
PPRVFVGEDFTIECTVSPVQPLERLTLSLLRGRETLKNQTFGGAETVPQEATATFNSTAL
KKDGLNFSCQAELDLRPHGGYIIRSISEYQILEVYEPMQDNQMVIIIVVVSILLFLFVTS
VLLCFIFGQHWHRRRTGTYGVLAAWRRLPRAFRARPV
NT seq 834 nt   +upstreamnt  +downstreamnt
atgtcttcttttgcttgctggagcctgtctcttcttatcctgttctacagcccagggtct
ggtgagaaggcctttgaggtctacatatggtccgagaagcagatagtagaagccacagag
tcttggaaaatcaactgcagcaccaactgcgcagccccagacatgggcggcctggagacg
cccacgaataaaataatgttggaagagcatcctcaagggaagtggaaacagttcttagtc
tcaaacgtctccaaagacacggtcttcttttgccatttcacgtgttcgggaaagcagcac
tcggagagtctcaacatcagggtgtaccagcctccagctcaagtcacactgaagctgcag
ccgcctcgggtgtttgtgggtgaagacttcaccattgagtgcacggtgtcccctgtgcag
ccccttgagaggctcaccctctctctgctccgtggcagagagaccctgaagaatcagacc
tttgggggagcagaaactgtcccccaagaggccacagccacgttcaacagcacagctctg
aaaaaggacggtctcaacttttcctgccaggctgagctggatctacggccccatggtggg
tatatcatccgcagcatctcggagtaccagatccttgaagtctatgagccgatgcaggac
aaccaaatggtcatcatcatcgtggtggtgtcaatactgctgttcttatttgtgacatct
gtcctgctatgctttatctttggccagcactggcacagaagacggacaggcacctacggg
gtgctagctgcctggaggaggctgccccgagcctttcgggcacgtcccgtgtga

DBGET integrated database retrieval system