KEGG   Mus musculus (house mouse): 15898
Entry
15898             CDS       T01002                                 
Symbol
Icam5, CD50, ICAM-3, Icam3, TLN, Tlcn
Name
(RefSeq) intercellular adhesion molecule 5, telencephalin
  KO
K06769  intercellular adhesion molecule 5
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    15898 (Icam5)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set ig ICAM_N V-set C2-set_2 Izumo-Ig
Other DBs
NCBI-GeneID: 15898
NCBI-ProteinID: NP_032345
MGI: 109430
Ensembl: ENSMUSG00000032174
UniProt: Q60625
Position
9:20943158..20950332
AA seq 917 aa
MPGPSPGLRRALLGLWAALGLGILGISAVALEPFWADLQPRVALVERGGSLWLNCSTNCP
RPERGGLETSLRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRP
DRVELVPLPSWQPVGENFTLSCRVPGAGPRASLTLTLLRGGQELIRRSFVGEPPRARGAM
LTARVLARREDHRVNFSCLAELDLRPHGLGLFANSSAPRQLRTFAMPPHSPSLIAPRVLE
VDSERPVTCTLDGLFPAPEAGVYLSLGDQRLNPNVTLDGDSLVATATATASAEQEGTKQL
MCVVTLGGESRETQENLTVYSFPTPLLTLSEPEAPEGKMVTISCWAGARALVTLEGIPAA
VPGQPAELQLNVTKNDDKRGFFCDAALDVDGETLRKNQSSELRVLYAPRLDDLDCPRSWT
WPEGPEQTLHCEARGNPEPSVHCARPEGGAVLALGLLGPVTRALAGTYRCTAVNGQGQAV
KDVTLTVEYAPALDSVGCPEHITWLEGTEASLSCVAHGVPPPSVSCVRSGKEEVMEGPLR
VAREHAGTYRCEAINARGSAAKNVAVTVEYGPSFEELGCPSNWTWVEGSGKLFSCEVDGK
PEPRVECVGSEGASEGIVLPLVSSNSGPRNSMTPGNLSPGIYLCNATNRHGSTVKTVVVS
AESPPQMDESSCPSHQTWLEGAEATALACSARGRPSPRVHCSREGAARLERLQVSREDAG
TYRCVATNAHGTDSRTVTVGVEYRPVVAELAASPPSVRPGGNFTLTCRAEAWPPAQISWR
APPGALNLGLSSNNSTLSVAGAMGSHGGEYECAATNAHGRHARRITVRVAGPWLWVAVGG
AAGGAALLAAGAGLAFYVQSTACKKGEYNVQEAESSGEAVCLNGAGGTPGAEGGAETPGT
AESPADGEVFAIQLTSS
NT seq 2754 nt   +upstreamnt  +downstreamnt
atgccggggccttcgccagggctgcgccgagcgctcctcggcctctgggctgccctgggc
ctggggatcctaggcatctcagcggtcgcgctagaacctttctgggcggaccttcagccc
cgcgtggcgctcgtggagcgcgggggctcgctgtggctcaactgcagcactaactgtccg
cggccggagcgcggtggcctggagacctcgctacgccgaaacgggacccagaggggtctg
cgctggctggctcggcagctggtggacatccgagagcctgagacccagccggtctgcttc
ttccgctgcgcgcgccgcacactccaagcgcgtggactcatccgaactttccagcgaccg
gatcgggtagagctggtgccgctcccttcttggcagccagtgggcgagaacttcaccttg
agctgcagggtcccgggagcaggaccccgagcgagcctcacattgaccctgctgcggggc
ggccaggagctgattcgccgcagtttcgtaggcgagccaccccgagcgcggggtgcgatg
ctcaccgccagggtcctggcacgcagggaggaccacagggtcaatttctcatgcctcgcc
gagcttgacctgcggccacacggcttgggactgtttgcaaatagctcggcccccagacag
ctccgtacctttgccatgcctccacattccccgagtcttattgctccccgagtcttagaa
gtggactcagaaaggccggtgacttgcacgttggatggactgtttcctgccccagaagcc
ggggtttacctctctctgggagatcagaggctcaatcctaatgtgaccctcgatggggac
agccttgtggccactgccacagctacagcaagcgcagaacaggaaggcaccaaacagctg
atgtgcgtcgtgaccctcgggggcgaaagcagggagacccaggaaaacctgactgtttac
agcttcccgactcctcttctgactttgagtgagccagaagcccccgagggaaaaatggtg
accataagctgctgggcaggggctcgagcccttgtcaccctggagggaattccagctgcg
gtcccggggcagcccgctgagctccagttaaatgttacaaagaacgatgacaagcggggc
ttcttctgcgacgccgccctcgatgtggacggggaaactctaagaaaaaaccagagctct
gagcttcgtgtcctgtatgcacctcgcctggatgacttggattgtcccagaagctggacg
tggccagagggtccagagcagaccctccactgcgaggcccgcggaaaccctgagccctcg
gtgcactgtgcaaggcctgagggcggggcggtgctagcgctgggcctattgggtccagtg
acccgtgccctcgcaggcacttaccgatgcacagcagtcaatgggcaaggccaggcggtc
aaagatgtgaccctgaccgtggaatatgccccagcgctggacagtgtaggctgcccagaa
catattacttggctggagggaacggaggcatcgcttagctgtgtggcacacggggtccca
ccacctagcgtgagttgtgtgcgctctggaaaggaggaagtcatggaagggcctctgcgc
gtggcccgggagcacgccggcacttaccgatgcgaagccatcaacgccagaggatcagcg
gccaaaaatgtggccgtcacggtggaatatggtcccagttttgaggagttgggctgcccc
agcaactggacgtgggtagagggatctggaaagctgttttcctgtgaagttgatgggaag
ccagaaccacgtgtggagtgcgtaggctcggagggtgcaagcgaagggatagtgttgccc
ttggtgtcctcaaactctggtcctagaaactctatgacccctggtaacctgtcaccgggc
atttacctctgcaacgccaccaaccggcacggctccacagtcaaaacagtcgtcgtgagc
gcggagtcgccgccacagatggatgaatccagttgcccgagtcaccagacctggctggaa
ggagctgaggctaccgcgctggcctgcagtgccaggggccgcccctctccacgggtgcat
tgctccagggagggtgccgccaggctggagaggctacaggtgtcccgagaggatgcgggg
acctaccgctgtgtggccaccaatgcgcatggcacggattcacggacggtcactgtgggt
gtggaataccggcctgtggtggctgagctggcagcctcgcccccaagcgtgcggccgggc
ggtaacttcactctgacctgccgcgcagaggcttggcctccagcccagatcagctggcgc
gcgcccccgggggctctcaacctcggcctctccagcaacaatagcactctgagcgtggcg
ggagccatgggcagccatggcggcgagtatgagtgtgcagcgaccaatgcgcatgggcgc
cacgcacggcgcatcacagtgcgcgtggccggtccatggctgtgggtcgctgtgggcggt
gcggcagggggcgcggcgctgctggccgctggggccggcctggccttctacgtgcaatcc
accgcttgcaagaagggcgagtacaacgtccaggaggctgagagctcaggcgaggccgtg
tgtctcaatggcgcgggcgggacaccgggtgcagaaggcggagcagagaccccaggcact
gcagagtcacctgcagatggcgaggttttcgctatccagctgacatcttcctga

DBGET integrated database retrieval system