KEGG   Mus musculus (mouse): 15925
Entry
15925             CDS       T01002                                 

Gene name
Ide, 1300012G03Rik, 4833415K22Rik, AA675336, AI507533
Definition
(RefSeq) insulin degrading enzyme
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    15925 (Ide)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    15925 (Ide)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     15925 (Ide)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M16: pitrilysin family
   15925 (Ide)
SSDB
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Other DBs
NCBI-GeneID: 15925
NCBI-ProteinID: NP_112419
MGI: 96412
Ensembl: ENSMUSG00000056999
Vega: OTTMUSG00000029864
UniProt: Q8CGB9
Position
19 C2; 19 32.24 cM
AA seq 1019 aa
MRNGLVWLLHPALPGTLRSILGARPPPAKRLCGFPKQTYSTMSNPAIQRIEDQIVKSPED
KREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIPGLSHFCEHMLFLGTKK
YPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDASCKD
REVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGIDVREE
LLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPFQEEHLRQ
LYKIVPIKDIRNLYVTFPIPDLQQYYKSNPGHYLGHLIGHEGPGSLLSELKSKGWVNTLV
GGQKEGARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAV
AFRFKDKERPRGYTSKIAGKLHYYPLNGVLTAEYLLEEFRPDLIDMVLDKLRPENVRVAI
VSKSFEGKTDRTEQWYGTQYKQEAIPEDIIQKWQNADLNGKFKLPTKNEFIPTNFEILSL
EKDATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSPFAYVDPLHCNMAYLYLELL
KDSLNEYAYAAELAGLSYDLQNTIYGMYLSVKGYNDKQPILLKKITEKMATFEIDKKRFE
IIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELKEALDDVTLPRLKAFIPQLL
SRLHIEALLHGNITKQAALGVMQMVEDTLIEHAHTKPLLPSQLVRYREVQLPDRGWFVYQ
QRNEVHNNCGIEIYYQTDMQSTSENMFLELFCQIISEPCFNTLRTKEQLGYIVFSGPRRA
NGIQGLRFIIQSEKPPHYLESRVEAFLITMEKAIEDMTEEAFQKHIQALAIRRLDKPKKL
SAECAKYWGEIISQQYNYDRDNIEVAYLKTLTKDDIIRFYQEMLAVDAPRRHKVSVHVLA
REMDSCPVVGEFPSQNDINLSEAPPLPQPEVIHNMTEFKRGLPLFPLVKPHINFMAAKL
NT seq 3060 nt   +upstreamnt  +downstreamnt
atgcggaacgggctcgtgtggctgctgcaccccgcgctgcccggcaccttgcgctccatc
ctcggcgcccgcccgccgcccgcgaagcgactgtgtggattcccaaaacagacttacagc
acaatgagtaatccggccatccagagaatagaagaccaaattgtcaagtctcctgaagac
aaacgggaataccgtggactagagctggccaatggcatcaaagtgcttctcatcagcgat
cccaccacagacaagtcctcagcggccctcgatgtgcacataggttcactgtcagaccct
ccaaatattcctggcttaagtcatttttgtgaacatatgctgtttttgggaaccaagaaa
tatcctaaagaaaatgaatatagccagtttctcagtgaacatgctggaagttcaaatgca
ttcaccagtggagaacacaccaattattatttcgatgtttcccatgaacacttggaagga
gccctggacaggtttgcgcagtttttcctgtgccccttgtttgatgcaagttgtaaagac
agagaggtgaacgctgtcgattcagaacatgagaagaatgtgatgaacgatgcctggaga
ctcttccagctggaaaaggctacggggaaccccaaacaccccttcagcaaatttgggaca
ggaaacaaatatactctagagactcggcccaaccaagaaggcatcgacgtaagggaagag
ctcttgaaatttcactctacgtattattcgtccaatctgatggcgatttgtgttttaggt
cgagaatccttagacgacctcactaacctggtggtgaagctgttctccgaggtggagaac
aagaacgttcctctgcctgagttccctgagcaccctttccaggaagagcatctcaggcaa
ctttataaaatagtacccattaaggatattagaaatctttatgtgacatttcccatacca
gaccttcagcagtactacaaatccaatcctggtcattatcttggtcatctaattgggcac
gaaggtcctggaagcctgttgtcagaactcaaatcaaagggctgggtgaataccctggtt
ggtggacagaaggaaggagcccgaggttttatgttttttatcattaatgtggacttaact
gaagaagggttattgcacgttgaagatataattttgcacatgtttcaatacattcagaag
ctacgtgcagaaggacctcaagaatgggttttccaagagtgcaaggacttgaatgctgtt
gctttcagatttaaagataaagagagaccacgaggctatacgtccaagattgcaggaaag
ttgcactattatcccctaaatggagtgctcacagctgaatatctattggaggaatttaga
cccgacttgatagacatggttcttgataaactcagaccagaaaatgtgcgggtggcaata
gtttccaaatcatttgaagggaaaactgaccgcacagagcagtggtatggaacacagtat
aagcaagaagctatcccagaggacatcattcagaaatggcaaaatgctgaccttaatgga
aaatttaagcttccaacaaagaatgaatttattcccacaaattttgagattttgtcatta
gaaaaagatgcaacaccataccctgctcttattaaggatacagccatgagtaagctgtgg
ttcaaacaagatgataaatttttcttgccgaaagcttgtctcaactttgaatttttcagc
ccgtttgcttatgtggaccccttgcactgtaacatggcctatttgtaccttgagctcctc
aaagactcactcaacgagtatgcatatgcagcagagctagcaggcctgagctatgacctc
caaaataccatctatgggatgtatctctcagtgaaaggttacaatgacaaacagccaatt
ttgctgaagaagatcaccgagaaaatggctacttttgagattgataagaagagatttgaa
attatcaaagaggcctatatgcgatctcttaataacttccgggctgagcagcctcaccag
catgccatgtactacctccgcttgctgatgactgaagtggcctggactaaagatgagcta
aaagaagcccttgacgatgttaccctcccccgacttaaggccttcatacctcagctgctg
tcacggctgcatattgaagcacttctccatggaaacataaccaagcaggctgccttagga
gttatgcagatggtagaagacactcttatcgagcatgctcacaccaaacctctccttcca
agtcagctagtccggtacagagaagtccagctccctgacagaggatggtttgtttatcag
cagaggaatgaagttcacaataactgcggcatcgagatctactaccagacagacatgcag
agcacctcggagaacatgttcctggagctgttttgccagattatctcggagccttgcttc
aataccctgcgcaccaaggagcagcttggctatattgtcttcagtggaccccgtcgggcc
aacggtatccaaggcttgcgcttcatcatccagtcagaaaaaccaccccactacctggag
agcagagtagaagccttcttgattaccatggaaaaggccatagaggacatgacagaggag
gcgttccaaaaacacattcaagcactagcgattcggcgactcgacaaaccaaagaaactc
tctgcggagtgtgctaaatactggggggaaatcatctcgcagcagtacaattacgacaga
gataacatagaagttgcatatttaaagacacttaccaaggacgatatcatcagattctac
caggaaatgttggctgtcgacgcaccgaggagacataaagtgtctgtccatgttcttgcc
agggaaatggattcttgtcctgttgttggagagttcccctctcagaatgatataaacttg
tccgaagcgccacccttgccacaacctgaagtgattcacaacatgactgagttcaagcgt
ggcctgccactgtttcccctcgtgaaaccacatattaacttcatggctgcaaaactctga

DBGET integrated database retrieval system