KEGG   Mus musculus (mouse): 15926
Entry
15926             CDS       T01002                                 

Gene name
Idh1, AI314845, AI788952, E030024J03Rik, ID, Id-, Id-1, Idh-, Idh-1, Idpc
Definition
(RefSeq) isocitrate dehydrogenase 1 (NADP+), soluble
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00480  Glutathione metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01210  2-Oxocarboxylic acid metabolism
mmu01230  Biosynthesis of amino acids
mmu04146  Peroxisome
mmu05230  Central carbon metabolism in cancer
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    15926 (Idh1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    15926 (Idh1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    15926 (Idh1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    15926 (Idh1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     15926 (Idh1)
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 15926
NCBI-ProteinID: NP_001104790
MGI: 96413
Ensembl: ENSMUSG00000025950
Vega: OTTMUSG00000021898
UniProt: O88844
Structure
PDB: 
5YZH 5YZI

Position
1 C2- C3; 1 32.91 cM
AA seq 414 aa
MSRKIQGGSVVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VTGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPKDGTQKVTYMVHDFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKKYKSQFE
AQKICYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWSRGLAHRAKLDNNTELSFFAKALE
DVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKAKLAQAKL
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgtccagaaaaatccaaggaggttctgtggtggagatgcaaggagatgaaatgacacga
atcatttgggaattgattaaggaaaaacttattcttccctatgtggaactggatctgcat
agctatgatttaggcatagagaatcgtgatgccaccaatgaccaggtcaccaaagatgct
gcagaggctataaagaaatacaacgtgggcgtcaagtgtgctaccatcacccccgatgag
aagagggttgaagaattcaagttgaaacaaatgtggaaatccccaaatggcaccatccga
aacattctgggtggcactgtcttcagggaagctattatctgcaaaaatatcccccggcta
gtgacaggctgggtaaaacccatcatcattggccgacatgcatatggggaccaatacaga
gcaactgattttgttgttcctgggcctggaaaagtagagataacctacacaccaaaagat
ggaactcagaaggtgacatacatggtacatgactttgaagaaggtggtggtgttgccatg
ggcatgtacaaccaggataagtcaattgaagactttgcacacagttccttccaaatggct
ctgtccaagggctggcctttgtatctcagcaccaagaacactattctgaagaagtatgat
gggcgtttcaaagacatcttccaggagatctatgacaagaaatacaagtcccagtttgaa
gctcagaagatctgctatgaacacaggctcatagatgacatggtggcccaagctatgaag
tccgagggaggcttcatctgggcctgtaagaattacgatggggatgtgcagtcagactca
gtcgcccaaggttatggctcccttggcatgatgaccagtgtgctgatttgtccagatggt
aagacggtagaagcagaggctgcccatggcactgtcacacgtcactaccgcatgtaccag
aaagggcaagagacgtccaccaaccccattgcttccatttttgcctggtcccgagggtta
gcccacagagcaaagcttgataacaatactgagctcagcttcttcgcaaaggctttggaa
gacgtctgcattgagaccattgaggctggctttatgactaaggacttggctgcttgcatt
aaaggcttacccaatgtacaacgttctgactacttgaatacatttgagtttatggacaaa
cttggagaaaacttgaaggccaaattagctcaggccaaactttaa

KEGG   Mus musculus (mouse): 269951
Entry
269951            CDS       T01002                                 

Gene name
Idh2, E430004F23, ID, IDPm, Idh-, Idh-2
Definition
(RefSeq) isocitrate dehydrogenase 2 (NADP+), mitochondrial
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00480  Glutathione metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01210  2-Oxocarboxylic acid metabolism
mmu01230  Biosynthesis of amino acids
mmu04146  Peroxisome
mmu05230  Central carbon metabolism in cancer
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    269951 (Idh2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    269951 (Idh2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    269951 (Idh2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    269951 (Idh2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     269951 (Idh2)
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 269951
NCBI-ProteinID: NP_766599
MGI: 96414
Ensembl: ENSMUSG00000030541
Vega: OTTMUSG00000024961
UniProt: P54071
Structure
PDB: 
5H3E 5H3F

Position
7 D2; 7 45.43 cM
AA seq 452 aa
MAGYLRAVSSLCRASGSARTWAPAALTVPSWPEQPRRHYAEKRIKVEKPVVEMDGDEMTR
IIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALATQKYSVAVKCATITPDE
ARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYK
ATDFVVDRAGTFKLVFTPKDGSSAKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYSI
QKKWPLYLSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKS
SGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQK
GRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVQTVESGAMTKDLAGCIH
GLSNVKLNEHFLNTTDFLDTIKSNLDRALGKQ
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggccggctacctgcgggctgtgagctcgctctgcagagcctcgggctcagcgcggacc
tgggcaccggcagcactgactgtccccagctggccggagcagccgcggcgccactatgct
gagaagaggatcaaggtggagaagccggtagtggagatggacggtgacgagatgacccgg
atcatctggcagttcatcaaggagaagctcatcctgcctcacgtggatgttcagctcaag
tattttgaccttgggcttccaaaccgtgaccagaccaatgaccaggtcaccattgactct
gctctggccacccagaagtacagtgtggctgtcaagtgtgccacaatcacccctgatgag
gcccgtgtggaagagttcaagctgaagaaaatgtggaagagccctaacggaacgatccgg
aacatccttgggggaaccgtcttcagagagccaatcatctgcaaaaacatcccccgcctt
gtccctggctggaccaagcccatcaccattggcaggcacgcccatggcgaccagtacaag
gccacagattttgtggtagatcgagctggcacgttcaagttggtcttcaccccaaaggat
ggcagcagtgccaaggagtgggaggtgtataacttccctgccggaggcgttgggatgggg
atgtacaacaccgacgagtccatttcgggcttcgcgcacagctgcttccagtactctatc
cagaagaaatggccgctctacttgagcaccaagaacaccattctgaaggcctatgacggg
cgtttcaaggacatcttccaggagatctttgacaagcactataagactgacttcgacaag
aataagatctggtatgaacatcggctcatcgacgacatggtggcccaggtgctcaagtct
tccggtggctttgtgtgggcttgcaaaaactatgatggagacgtgcagtctgacatcctg
gctcaaggctttggctccctcggcctgatgacatctgtgctggtctgccctgatgggaag
acaattgaggctgaggctgctcatgggacagtcacccgccattaccgagaacaccagaag
ggccggcccaccagtaccaaccctattgccagcatctttgcctggacacggggtctggag
catcgtgggaagctggatgggaaccaggaccttatcaggtttgcacagacgctggagaag
gtgtgcgtgcagactgtggagagcggagcgatgaccaaggacctggctggctgtatccat
ggcctcagcaatgtgaagctgaacgagcacttcctgaacaccacagacttcctggacacc
attaagagcaacctggacagagctctgggcaagcagtag

DBGET integrated database retrieval system