KEGG   Mus musculus (mouse): 15929
Entry
15929             CDS       T01002                                 

Gene name
Idh3g
Definition
(RefSeq) isocitrate dehydrogenase 3 (NAD+), gamma
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01210  2-Oxocarboxylic acid metabolism
mmu01230  Biosynthesis of amino acids
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    15929 (Idh3g)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     15929 (Idh3g)
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 15929
NCBI-ProteinID: NP_032349
MGI: 1099463
Ensembl: ENSMUSG00000002010
Vega: OTTMUSG00000017673
UniProt: P70404 Q3TGZ3
Position
X A7.3; X 37.41 cM
AA seq 393 aa
MALKVAIAAGGAAKAMLKPTLLCRPWEVLAAHVAPRRSISSQQTIPPSAKYGGRHTVTMI
PGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIET
NHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHE
SVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVA
AHYPQITFDSMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYG
HVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNEN
MHTPDIGGQGTTSQAIQDIIRHIRIINGRAVEA
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggcgctgaaggtggcgatagctgctggcggtgctgcaaaggcaatgctcaagccaact
ctcctctgccgtccttgggaggttctggctgcccatgtggccccccgaaggagcatttcc
tcacaacaaacaattcctccatctgctaagtatggtgggcggcatacagtgactatgatc
ccaggggatggcatcggcccagagctcatgttgcatgttaagtctgtattcaggcatgca
tgtgtgccggtggactttgaagaggtgcatgtaagctccaacgctgatgaggaggacatc
cgcaatgccatcatggccatccgccggaaccgtgtggccctgaagggcaacattgaaaca
aatcataacctgccaccatcccacaaatctcgaaacaacatccttcgcaccagcctagac
ctctatgccaacgtcatccactgtaagagcctgccaggagtggtgacccggcacaaggac
atagacatcctcattgtacgggaaaacacagaaggcgagtacagcagcctggagcatgag
agcgtagcaggagtggtggagagcttgaagattatcaccaaagccaagtccctgcgcatt
gctgaatatgctttcaagctggcccaggagagtgggcgtaagaaagtgacggctgtgcac
aaggccaacatcatgaaactgggtgatggactcttcctccagtgctgcagggaagtagca
gcccactaccctcagatcacctttgacagcatgattgtagacaacacaacaatgcagctg
gtatcccggcctcagcagtttgatgtcatggtgatgcctaatctctatggtaacattgtc
aacaacgtctgtgcagggctagttggaggcccaggccttgtggctggggccaactatggc
catgtgtatgcagtattcgagacagctacaaggaacacaggcaaaagtattgccaataag
aacattgctaacccgactgccacactgctagcaagctgcatgatgctagaccacctcaag
ctccactcctatgccacttccatccgcaaagctgtcttagcatccatggacaatgaaaat
atgcataccccagatattggaggccagggcaccacatcccaagccatccaggacatcatt
cgtcatatccgcatcattaatggacgggctgtggaggcttag

KEGG   Mus musculus (mouse): 170718
Entry
170718            CDS       T01002                                 

Gene name
Idh3b, C78231
Definition
(RefSeq) isocitrate dehydrogenase 3 (NAD+) beta
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01210  2-Oxocarboxylic acid metabolism
mmu01230  Biosynthesis of amino acids
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    170718 (Idh3b)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     170718 (Idh3b)
SSDB
Motif
Pfam: Iso_dh AAA_3
Other DBs
NCBI-GeneID: 170718
NCBI-ProteinID: NP_001349681
MGI: 2158650
Ensembl: ENSMUSG00000027406
Vega: OTTMUSG00000015521
Position
2; 2 F1
AA seq 380 aa
MAALSNVRWLTRAVLAARNSGAWRGLGTSTAHAASQSQAQDVRVEGAFPVTMLPGDGVGP
ELMHAVKEVFKAAAVPVEFKEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIYTPMEY
KGELASYDMQLRRKLDLFANVVHVKSLPGYKTRHNNLDLVIIREQTEGEYSSLEHESAKG
VIECLKIVTRTKSQRIAKFAFDYATKKGRSKVTAVHKANIMKLGDGLFLQCCEEVAELYP
KIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYA
VFETGARHPFAQAVGRNIANPTAMLLSATNMLRHLNLEYHSSMIADAVKKVIKAGKVRTS
DMGGYATCHDFTEAVITALS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcagcgctgagcaatgtccgctggctgacccgagcggtgctcgccgctcggaactcc
ggggcatggagaggtctcggaacatctacggctcacgccgcttcccagagccaggcacaa
gatgtgagggtggagggtgcctttcctgtgaccatgctgcctggagacggcgtggggcca
gagctcatgcatgctgtcaaggaagtgttcaaggctgctgctgtccctgtggaatttaag
gagcatcatctgagcgaggtgcagaatatggcttctgaggagaagctggagcaggtgctg
agttccatgaaggagaacaaagttgccatcattggaaagatctataccccaatggagtat
aagggtgaactagcctcctatgatatgcagctgaggcgtaagttggatttgtttgccaac
gtagtccacgtgaagtcacttcctggatacaagactcggcacaacaatctagacctggtt
atcattcgagagcagacagaaggggagtatagctctctggaacatgagagcgccaagggt
gtcattgagtgcctgaagatcgtcactcgcaccaagtctcagaggattgcaaagtttgcg
ttcgactatgccaccaagaaagggcggagcaaggtcacagccgtccataaagccaacatc
atgaaactaggggatggcttgttcttgcagtgctgtgaggaagttgctgaactgtaccct
aaaatcaagtttgaaaccatgatcatagacaactgctgcatgcagctggtgcagaaccct
taccagtttgatgtgctcgtgatgcccaatctctatggcaacataattgacaatctggct
gctggccttgttgggggagctggcgtggttcctggggagagctacagtgcagagtatgca
gtttttgagacgggtgctcggcacccatttgcccaggcagtgggcaggaatatagccaac
cccacagccatgctgctgtcggccaccaacatgctgcggcatctcaatcttgagtatcac
tccagcatgattgcagatgcagtgaagaaagtgatcaaagctggcaaggttcgaacctca
gatatgggtggttatgccacatgtcatgacttcactgaagctgtcattactgccctgtca
taa

KEGG   Mus musculus (mouse): 243996
Entry
243996            CDS       T01002                                 

Gene name
4933405O20Rik
Definition
(RefSeq) RIKEN cDNA 4933405O20 gene
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01210  2-Oxocarboxylic acid metabolism
mmu01230  Biosynthesis of amino acids
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    243996 (4933405O20Rik)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     243996 (4933405O20Rik)
SSDB
Motif
Pfam: Iso_dh DUF4427
Other DBs
NCBI-GeneID: 243996
NCBI-ProteinID: NP_766489
MGI: 2142174
Ensembl: ENSMUSG00000084234
Vega: OTTMUSG00000024738
UniProt: Q8BPC6
Position
7; 7 B4
AA seq 396 aa
MLAVTSCSMKTVLQYAVFLGHSREVVCELVTSFRSFCSHCAVPPSPKYGGRHTVAMIPGD
GIGPELMVHVKKIFRSNCVPVDFEEVWVTSTSNEEEINNALMAIRRNRVALKGNIATNHN
LPARYKSHNTKFRTILDLYASVVHFKTFPGVMTRHKDIDILVVRENTEGEYTNLEHESVK
GVVESLKIVTKTKSVRIADYAFKLAQKMGRKKVTVVHKANIMKLGDGLFLQCCKDVAAHY
PQITLESMIIDNTTMQLVSKPQQFDVMVMPNLYGNIINSICTGLVGGSGIVPGANYGDSY
AIFEMGSKEIGKDLAHRNIANPVAMLLTSCIMLDYLDLQPYATHIRSAVMASLQNKAVCT
PDIGGQGNTASTVEYILHHMKEQTSGCHPNFFLQFT
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgttggcagtaaccagctgttctatgaaaacagttctccaatatgctgtgtttcttggc
cattctagggaggtagtgtgtgagcttgtgacctccttcagaagtttctgctcacattgc
gcagtgcctccttcaccaaagtatggaggaagacacacggtggctatgattcctggagat
ggcattgggcctgagcttatggttcatgtcaagaaaatattcagatcaaattgtgtgcca
gtggactttgaagaggtgtgggtcacctcgacatctaatgaagaggagatcaacaatgct
ctcatggccatccgtcggaaccgtgtcgctctgaagggcaatattgcaaccaaccacaat
ctgcctgcccgttacaagtctcacaacaccaagtttcgcaccatccttgacctctatgcc
agtgtcgtccatttcaagacttttcctggtgttatgacccgacacaaagacatagacatc
ttggttgttcgggagaatacagagggggagtacactaacctagagcatgagagcgtgaaa
ggcgtggtagaaagccttaagattgtgacaaagaccaagtctgtgcgcattgctgattat
gccttcaagttggcccaaaagatggggcggaaaaaggtgacagttgttcacaaagccaac
atcatgaaactgggagatgggctcttccttcagtgctgtaaggatgtggcagctcactat
cctcagatcaccttagagagtatgattatagacaacaccacaatgcagttggtatcgaag
ccccaacagtttgatgtcatggtgatgcccaatctttatggcaacattatcaacagtatc
tgcacaggactggttggagggtcaggaattgtccctggagccaattatggtgattcatat
gcaatatttgagatgggttcaaaggaaataggtaaagatttggctcacagaaatattgcc
aatcctgtcgccatgctgctgaccagctgtatcatgctggactaccttgatctccaaccc
tatgccactcacatccgctctgcagtcatggcgtccttacaaaacaaagctgtctgcact
ccagacattggaggtcaagggaacactgcaagcactgtagagtatatcttacaccacatg
aaagaacaaactagtggttgtcatccaaatttcttcctgcagttcacttga

KEGG   Mus musculus (mouse): 67834
Entry
67834             CDS       T01002                                 

Gene name
Idh3a, 1110003P10Rik, 1500012E04Rik, AA407078, AI316514
Definition
(RefSeq) isocitrate dehydrogenase 3 (NAD+) alpha
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01210  2-Oxocarboxylic acid metabolism
mmu01230  Biosynthesis of amino acids
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    67834 (Idh3a)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     67834 (Idh3a)
SSDB
Motif
Pfam: Iso_dh FliM
Other DBs
NCBI-GeneID: 67834
NCBI-ProteinID: NP_083849
MGI: 1915084
Ensembl: ENSMUSG00000032279
Vega: OTTMUSG00000063242
UniProt: Q9D6R2
Position
9; 9 A5.3
AA seq 366 aa
MAGSAWVSKVSRLLGAFHNTKQVTRGFAGGVQTVTLIPGDGIGPEISASVMKIFDAAKAP
IQWEERNVTAIQGPGGKWMIPPEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDL
YANVRPCVSIEGYKTPYTDVNIVTIRENTEGEYSGIEHVIVDGVVQSIKLITEEASKRIA
EFAFEYARNNHRSNVTAVHKANIMRMSDGLFLQKCREVAENCKDIKFNEMYLDTVCLNMV
QDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGANGVAIFESVHGTAPDIAGKD
MANPTALLLSAVMMLRHMGLFDHAAKIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICR
RVKDLD
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggccgggtccgcgtgggtgtccaaggtctctcggctgctgggtgcattccacaacaca
aaacaggtgacaagaggttttgctggtggtgttcagacagtaactttaattcctggagat
ggaattggcccagaaatttcagcctcagtcatgaagatttttgatgctgccaaagcacct
attcagtgggaggagcgcaatgtcacagcaattcaaggaccaggaggaaagtggatgatc
cctccagaagccaaggagtccatggataagaacaagatgggcttgaaaggcccactaaag
accccaatagccgctggccatccatctatgaatctgttgcttcgtaagacatttgacctt
tatgccaatgtccggccatgtgtctcaattgaaggttataaaaccccttacacggatgta
aatatcgtcaccatccgagagaacacggaaggagaatacagtggaattgagcatgtgatc
gttgatggggttgtgcagagcatcaagctcatcaccgaagaagcaagcaagcgcattgca
gagtttgccttcgagtacgctcggaacaaccaccggagcaacgtcacagctgtgcacaaa
gctaacatcatgaggatgtcagatgggctctttctgcaaaaatgcagggaagttgcggag
aactgtaaagacattaaatttaacgagatgtaccttgatactgtatgtttaaatatggta
caagacccatcccagtttgatgttcttgtcatgccaaatttatacggagacatccttagt
gatctgtgtgcaggactgattggaggtcttggggtgactccaagtggcaatattggagcc
aacggtgttgccatctttgaatcggttcatggaacagccccggacattgcaggcaaggac
atggccaaccccacggccctcctgcttagtgctgtgatgatgcttcgccacatgggactt
tttgaccatgcagcaaaaatcgaggctgcatgttttgctacaattaaggatggaaagagc
ttaacaaaagatctgggaggcaacgcgaagtgctctgacttcacagaagaaatctgtcgt
agagtcaaagacttagattag

DBGET integrated database retrieval system