KEGG   Mus musculus (mouse): 15931Help
Entry
15931             CDS       T01002                                 

Gene name
Ids, AW214631
Definition
(RefSeq) iduronate 2-sulfatase
  KO
K01136  iduronate 2-sulfatase [EC:3.1.6.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00531  Glycosaminoglycan degradation
mmu01100  Metabolic pathways
mmu04142  Lysosome
Module
mmu_M00076  Dermatan sulfate degradation
mmu_M00078  Heparan sulfate degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    15931 (Ids)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    15931 (Ids)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.13  iduronate-2-sulfatase
     15931 (Ids)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfatase Phosphodiest DUF229
Motif
Other DBs
NCBI-GeneID: 15931
NCBI-ProteinID: NP_034628
MGI: 96417
Ensembl: ENSMUSG00000035847
Vega: OTTMUSG00000025736
UniProt: Q08890
Position
X A7.2; X 36.01 cM
AA seq 552 aa AA seqDB search
MSPPPPPPIWRQLSFSLLLGSFCIALESAAQGNSATDALNILLIIVDDLRPSLGCYGDKL
VRSPNIDQLASHSVLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHSGNFST
IPQYFKENGYVTMSVGKVFHPGISSNHSDDYPYSWSFPPYHPSSEKYENTKTCKGQDGKL
HANLLCPVDVADVPEGTLPDKQSTEEAIRLLEKMKTSASPFFLAVGYHKPHIPFRYPKEF
QKLYPLENITLAPDPHVPDSLPPVAYNPWMDIREREDVQALNISVPYGPIPEDFQRKIRQ
SYFASVSYLDTQVGHVLSALDDLRLAHNTIIAFTSDHGWALGEHGEWAKYSNFDVATRVP
LMLYVPGRTAPLPAAGQKLFPYRDPFDPASDWMDAGRHTEDLVELVSLFPTLAGLAGLPV
PPRCPIPSFHVELCREGQNLQKHLQLHDLEEEPDLFGNPRELIAYSQYPRPADFPQWNSD
KPSLNDIKVMGYSIRTVDYRYTVWVGFDPSEFLANFSDIHAGELYFVDSDPLQDHNVYND
SQHGGLLHSLRP
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgccgccgccgccgcctatctggcggcagcttagcttcagcttgttgctaggc
tccttctgcatcgccctggagtccgcagcgcaaggcaactctgctacagatgctctgaac
atccttctgatcattgtggatgatctccgcccctccctgggctgttatggagacaagcta
gtgaggtccccgaacattgaccagctggcatcccatagcgttctctttcagaatgccttt
gctcagcaagcagtgtgcgcaccaagtcgagtgtccttcctcaccgggaggaggcctgac
accacccgcctgtatgacttcaattcctactggagggtacattctggaaatttttccacc
atcccccaatacttcaaggagaatggctacgtgaccatgtcggttgggaaagtctttcac
cctggtatatcttccaatcacagtgatgattatccatatagctggtcttttccaccttat
catccatcctcagagaaatatgaaaacactaagacgtgtaagggacaagatggaaaactc
cacgccaatctgctttgtcctgtcgatgtggcagatgtgcctgaaggtaccttgcctgac
aaacagagcacagaagaagccatcaggttgttggaaaagatgaagacatcagctagtcct
ttcttcctggcagttgggtaccacaagccgcatatccccttcagataccccaaggaattt
cagaagttgtatcccttggaaaacataaccctggctcctgatccccatgttcctgatagc
ctaccacctgtagcctacaacccctggatggatatcagggagagggaagatgtccaagcc
ttaaacatcagtgttccctatggaccaattcctgaggattttcagcggaaaatccgccag
agctactttgcttctgtgtcctatttggatactcaggttggacatgttttgagtgctttg
gatgatcttcgtctagcccacaacacaattattgctttcacatctgatcacggatgggcc
ctaggtgaacacggagaatgggccaagtacagcaactttgatgttgctacccgtgtgccc
ctgatgctctatgtccctggaaggacggccccacttcctgcggcaggccagaagctcttt
ccataccgggacccctttgatccggcctcggattggatggatgcaggcaggcacaccgag
gacctcgtagaacttgtatctctcttccccacgctcgctggacttgcaggactgccagtt
cctcctcggtgccccatcccttcttttcatgttgagctttgcagagaaggccagaatctt
cagaagcatttgcagctccatgacttggaagaggagccagacttgtttggtaatccccgg
gagttgatcgcctatagccagtacccccggcctgcagatttccctcagtggaattctgac
aagccaagcttaaatgatataaaggtcatgggatattctatacgcactgtagactacagg
tacactgtgtgggttggcttcgatcctagtgaatttctggctaacttttctgatatccat
gccggggaactctattttgtcgattctgacccactgcaggatcacaatgtatataatgac
tcccaacatggaggtcttctccactcactgaggccttga

DBGET integrated database retrieval system