KEGG   Mus musculus (mouse): 15959
Entry
15959             CDS       T01002                                 

Gene name
Ifit3, Ifi, Ifi49, P49
Definition
(RefSeq) interferon-induced protein with tetratricopeptide repeats 3
  KO
K24849  interferon-induced protein with tetratricopeptide repeats 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    15959 (Ifit3)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  Tetratricopeptide repeat-containing proteins
   15959 (Ifit3)
SSDB
Motif
Pfam: TPR_19 TPR_8 TPR_12 TPR_2 TPR_1 TPR_14 TPR_17 TPR_7 NARP1 TPR_10 TPR_MalT ChAPs TPR_15 DUF4810 L27 Sec16_C CALM_bind
Other DBs
NCBI-GeneID: 15959
NCBI-ProteinID: NP_034631
MGI: 1101055
Ensembl: ENSMUSG00000074896
Vega: OTTMUSG00000016645
UniProt: Q64345 Q5FW82
Position
19; 19 C1
AA seq 403 aa
MSEVNRESLEAILPQLKCHFTWNLFREGSMSSHMEDRVCNQVEHLNSEEKATMYDLLAYI
KHLDGESKAALECLGQAEDLRKSEHNDQSEIRRLVTWGNYAWIYYHMGRLSEAQAYVDKV
RQVCQKFANPYSMECPELECEEGWTRLKCGRNERAKMCFEKALEEKPKDPECSSGMAIAM
FRLEEKPEKQFSVDALKQAMELNPQNQYLKVLLALKLLRMGEEAEGERLIKDALGKAPNQ
TDVLQKAAQFYKKKGNLDRAIELLGKALRSTVNNSPLYSLVMCRYREILEQLQNKGDADS
SERRQRMAELRRLTMEFMQKTLQRRRSPLNSYSDLIDFPEVERCYQMVISKESPDVEEED
LYERYCNLQEYHRKSEDLAALECLLQFPRNERSIEKEEVKEQT
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgagtgaggtcaaccgggaatctctggaagcgatccttccacagctgaagtgccatttc
acctggaatttattcagggaaggaagtatgtccagtcatatggaagacagggtgtgcaac
caggtcgaacatttaaactctgaggagaaggcaacaatgtatgacttattggcctacata
aagcacctagatggcgaaagcaaggccgccctggagtgcttagggcaagctgaagattta
aggaagtcagagcacaatgatcaatcagaaattcgtcgactggtcacctggggaaactac
gcctggatctactatcacatgggccgtctctcagaagctcaggcttacgttgacaaggtg
agacaagtttgccaaaagtttgcgaatccttacagcatggaatgcccagaacttgaatgt
gaggaaggatggacacgcctaaagtgtggaagaaatgaacgagcaaaaatgtgctttgaa
aaggctctagaagagaagccaaaggacccagagtgctcctctgggatggccatcgccatg
ttccgcctagaagaaaaacctgagaagcagttctccgtggatgctctgaagcaggccatg
gagttgaatcctcagaaccagtacctgaaagttctcctggccctgaaactgctgaggatg
ggagaagaagctgaaggggagcgattgattaaagatgctttggggaaagctcctaatcaa
acggatgtcctccaaaaggcagctcagttttacaagaaaaagggtaacctagacagagct
attgagttacttggaaaagcactgcgatccacagtgaacaacagtcctctctactctttg
gtcatgtgccgttacagggaaatactggagcagctacagaataaaggagatgctgacagc
agtgagagaagacagaggatggcagaactgagacgattaacgatggagttcatgcagaag
actcttcagaggaggcgaagtcctttgaactcctactcagatctcatcgatttcccggaa
gtagagagatgctatcagatggtcatcagtaaggagagccccgatgttgaggaagaagac
ctctatgagcgctattgcaacctccaggagtaccacaggaagtctgaagacctcgcagcc
ctggagtgtttgttgcaatttcccagaaatgaaaggtcaatcgagaaggaagaggttaaa
gagcaaacatag

DBGET integrated database retrieval system