KEGG   Mus musculus (mouse): 15967Help
Entry
15967             CDS       T01002                                 

Gene name
Ifna4, Ifa4
Definition
(RefSeq) interferon alpha 4
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  Jak-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    15967 (Ifna4)
   04151 PI3K-Akt signaling pathway
    15967 (Ifna4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15967 (Ifna4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15967 (Ifna4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15967 (Ifna4)
   04621 NOD-like receptor signaling pathway
    15967 (Ifna4)
   04622 RIG-I-like receptor signaling pathway
    15967 (Ifna4)
   04623 Cytosolic DNA-sensing pathway
    15967 (Ifna4)
   04650 Natural killer cell mediated cytotoxicity
    15967 (Ifna4)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    15967 (Ifna4)
  09163 Immune diseases
   05320 Autoimmune thyroid disease
    15967 (Ifna4)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    15967 (Ifna4)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    15967 (Ifna4)
   05162 Measles
    15967 (Ifna4)
   05164 Influenza A
    15967 (Ifna4)
   05161 Hepatitis B
    15967 (Ifna4)
   05160 Hepatitis C
    15967 (Ifna4)
   05168 Herpes simplex infection
    15967 (Ifna4)
   05163 Human cytomegalovirus infection
    15967 (Ifna4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15967 (Ifna4)
   05169 Epstein-Barr virus infection
    15967 (Ifna4)
   05165 Human papillomavirus infection
    15967 (Ifna4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15967 (Ifna4)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15967 (Ifna4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon CEP76-C2
Motif
Other DBs
NCBI-GeneID: 15967
NCBI-ProteinID: NP_034634
MGI: 107664
Ensembl: ENSMUSG00000070904
Vega: OTTMUSG00000011263
UniProt: P07351 Q540C2
Position
4 C4; 4 42.03 cM
AA seq 186 aa AA seqDB search
MARLCAFLMILVMMSYYWSACSLGCDLPHTYNLGNKRALTVLEEMRRLPPLSCLKDRKDF
GFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLSATWNATLLDSFCNDLHQQLNDL
KACVMQEPPLTQEDSLLAVRTYFHRITVYLRKKKHSLCAWEVIRAEVWRALSSSTNLLAR
LSEEKE
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctcatgatcctggtaatgatgagctactactggtcagcc
tgttctctaggatgtgacctgcctcacacttataacctcgggaacaagagggccttgaca
gtcctggaagaaatgagaagactcccccctctttcctgcctgaaggacaggaaggatttt
ggattccccttggagaaggtggataaccaacagatccagaaggctcaagccatccttgtg
ctaagagatcttacccagcagattttgaacctcttcacatcaaaagacttgtctgctact
tggaatgcaactctactagactcattctgcaatgacctccatcagcagctcaatgacctc
aaagcctgtgtgatgcaggaacctcctctgacccaggaagactccctgctggctgtgagg
acatacttccacaggatcactgtgtacctgagaaagaagaaacacagcctctgtgcctgg
gaggtgatcagagcagaagtctggagagccctctcttcctcaaccaacttgctggcaaga
ctgagtgaggagaaggagtga

DBGET integrated database retrieval system