KEGG   Mus musculus (mouse): 15975
Entry
15975             CDS       T01002                                 

Gene name
Ifnar1, I, If, Ifar, Ifnar, Ifrc, Infar
Definition
(RefSeq) interferon (alpha and beta) receptor 1
  KO
K05130  interferon receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15975 (Ifnar1)
   04151 PI3K-Akt signaling pathway
    15975 (Ifnar1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15975 (Ifnar1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15975 (Ifnar1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15975 (Ifnar1)
   04621 NOD-like receptor signaling pathway
    15975 (Ifnar1)
   04650 Natural killer cell mediated cytotoxicity
    15975 (Ifnar1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15975 (Ifnar1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15975 (Ifnar1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    15975 (Ifnar1)
   05160 Hepatitis C
    15975 (Ifnar1)
   05171 Coronavirus disease - COVID-19
    15975 (Ifnar1)
   05164 Influenza A
    15975 (Ifnar1)
   05162 Measles
    15975 (Ifnar1)
   05168 Herpes simplex virus 1 infection
    15975 (Ifnar1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15975 (Ifnar1)
   05169 Epstein-Barr virus infection
    15975 (Ifnar1)
   05165 Human papillomavirus infection
    15975 (Ifnar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    15975 (Ifnar1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IFN receptor family
   15975 (Ifnar1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 15975
NCBI-ProteinID: NP_034638
MGI: 107658
Ensembl: ENSMUSG00000022967
Vega: OTTMUSG00000027185
UniProt: P33896
Structure
PDB: 
3WCY

Position
16 C3.3; 16 52.98 cM
AA seq 590 aa
MLAVVGAAALVLVAGAPWVLPSAAGGENLKPPENIDVYIIDDNYTLKWSSHGESMGSVTF
SAEYRTKDEAKWLKVPECQHTTTTKCEFSLLDTNVYIKTQFRVRAEEGNSTSSWNEVDPF
IPFYTAHMSPPEVRLEAEDKAILVHISPPGQDGNMWALEKPSFSYTIRIWQKSSSDKKTI
NSTYYVEKIPELLPETTYCLEVKAIHPSLKKHSNYSTVQCISTTVANKMPVPGNLQVDAQ
GKSYVLKWDYIASADVLFRAQWLPGYSKSSSGSRSDKWKPIPTCANVQTTHCVFSQDTVY
TGTFFLHVQASEGNHTSFWSEEKFIDSQKHILPPPPVITVTAMSDTLLVYVNCQDSTCDG
LNYEIIFWENTSNTKISMEKDGPEFTLKNLQPLTVYCVQARVLFRALLNKTSNFSEKLCE
KTRPGSFSTIWIITGLGVVFFSVMVLYALRSVWKYLCHVCFPPLKPPRSIDEFFSEPPSK
NLVLLTAEEHTERCFIIENTDTVAVEVKHAPEEDLRKYSSQTSQDSGNYSNEEEESVGTE
SGQAVLSKAPCGGPCSVPSPPGTLEDGTCFLGNEKYLQSPALRTEPALLC
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgctcgctgtcgtgggcgcggcggccctggtgctggtggccggggcgccttgggtgcta
ccctcagctgcaggtggagaaaatctgaaacctcctgagaatatagacgtctacattata
gatgacaactacaccctaaagtggagcagccacggagagtcaatgggcagtgtgaccttt
tcagcagaatatcgaacaaaagacgaggcgaagtggttaaaagtgcctgaatgtcaacat
actacaacgaccaagtgtgaattctctttactggacacaaatgtgtatatcaaaacacag
tttcgtgtcagagcagaggaagggaacagcacatcttcgtggaatgaggttgatccgttt
attccattctacacagctcacatgagccccccagaagtacgtttagaagctgaagataaa
gccatactagtccacatctctcctcccggacaagacgggaacatgtgggcactggagaaa
ccttccttcagttacaccatacgaatctggcagaagtcttccagtgacaaaaaaactatt
aactctacgtattatgtagaaaagataccagaactcttgccagagactacttactgttta
gaagttaaagcaatacatccgtcacttaagaaacacagcaattacagcactgtgcagtgt
ataagcaccacagtggcaaataaaatgcctgtgccaggaaatctccaagtggatgcccaa
ggcaagagctatgtcctgaaatgggactacattgcgtctgcagacgtgctcttcagggca
cagtggcttcctggctattcaaaaagcagttctggaagccgttcagataaatggaaacca
ataccaacctgtgcaaatgtccagactacgcactgtgtcttttctcaagatactgtctac
acaggaacgttctttctccatgtacaagcctcagagggaaatcacacatccttttggtct
gaagagaagtttattgattctcaaaaacacattctccctcctcctccggtcattactgtc
accgccatgagtgacaccttgcttgtttatgtcaactgtcaggacagcacatgtgatgga
ctcaattacgaaatcatcttttgggaaaacacttccaatactaagataagcatggagaag
gatggcccagagttcaccctcaagaacctgcagccgctgactgtgtactgtgtccaggcc
agagtgctcttcagggccctgctgaataagaccagcaacttcagtgaaaagctgtgtgag
aaaacacgtccaggaagtttttccacgatctggattataactggattaggtgttgtgttc
ttctctgtcatggtcctttatgctttgaggagcgtctggaaatacctgtgtcatgtgtgc
ttcccaccactcaagcctccccgcagtattgatgagtttttctctgagccgccttcaaaa
aaccttgtacttctgacggctgaggagcacacggaaagatgcttcatcattgagaataca
gacacggtcgctgtagaagtaaagcacgcgcctgaggaggacctcaggaagtacagctca
cagaccagccaggactcgggcaactattccaacgaagaggaggagagtgtgggcaccgag
agcggccaagctgtgctctccaaagctccctgcggggggccatgcagcgtgcctagccct
cctgggaccttggaagacgggacctgcttcctgggaaatgaaaaatatcttcagagccca
gccctgaggacagagccagctcttctctgctga

KEGG   Mus musculus (mouse): 15976
Entry
15976             CDS       T01002                                 

Gene name
Ifnar2, AI747302, Ifn, Ifnar-2
Definition
(RefSeq) interferon (alpha and beta) receptor 2
  KO
K05131  interferon receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15976 (Ifnar2)
   04151 PI3K-Akt signaling pathway
    15976 (Ifnar2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15976 (Ifnar2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15976 (Ifnar2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15976 (Ifnar2)
   04621 NOD-like receptor signaling pathway
    15976 (Ifnar2)
   04650 Natural killer cell mediated cytotoxicity
    15976 (Ifnar2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15976 (Ifnar2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15976 (Ifnar2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    15976 (Ifnar2)
   05171 Coronavirus disease - COVID-19
    15976 (Ifnar2)
   05164 Influenza A
    15976 (Ifnar2)
   05162 Measles
    15976 (Ifnar2)
   05168 Herpes simplex virus 1 infection
    15976 (Ifnar2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15976 (Ifnar2)
   05169 Epstein-Barr virus infection
    15976 (Ifnar2)
   05165 Human papillomavirus infection
    15976 (Ifnar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    15976 (Ifnar2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IFN receptor family
   15976 (Ifnar2)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac IL6Ra-bind
Other DBs
NCBI-GeneID: 15976
NCBI-ProteinID: NP_034639
MGI: 1098243
Ensembl: ENSMUSG00000022971
Vega: OTTMUSG00000040135
UniProt: O35664
Position
16 C3.3; 16 52.82 cM
AA seq 513 aa
MRSRCTVSAVGLLSLCLVVSASLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKS
GPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTV
CRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDS
VRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSE
SAIVGITTSCLVVMVFVSTIVMLKRIGYICLKDNLPNVLNFRHFLTWIIPERSPSEAIDR
LEIIPTNKKKRLWNYDYEDGSDSDEEVPTASVTGYTMHGLTGKPLQQTSDTSASPEDPLH
EEDSGAEESDEAGAGAGAEPELPTEAGAGPSEDPTGPYERRKSVLEDSFPREDNSSMDEP
GDNIIFNVNLNSVFLRVLHDEDASETLSLEEDTILLDEGPQRTESDLRIAGGDRTQPPLP
SLPSQDLWTEDGSSEKSDTSDSDADVGDGYIMR
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgcgttcacggtgcaccgtctctgccgtcggtctcctcagcttgtgtcttgtggtgtct
gcgagcctagagactatcacaccgtctgcttttgatgggtatccagatgaaccttgcact
ataaacataacaatacgaaattcccggctaattttatcctgggaattagagaacaagtct
ggcccacccgctaactacaccctctggtacacagtcatgagcaaagacgaaaatctgacg
aaggttaagaactgttcagataccacgaagtcatcatgtgacgtgacagataagtggttg
gagggcatggagagctacgtcgtcgccatcgtcatagtgcacagaggggacttgaccgtg
tgccgctgctcagactacatcgtgcctgcaaacgctcctcttgagccgccagaatttgag
atcgttggctttacagaccacataaacgtgacgatggaatttccacctgtcacttccaaa
ataatccaggaaaagatgaagactacaccctttgtcatcaaagaacagataggggacagc
gttaggaagaagcacgagcccaaagtgaataatgtcactgggaacttcacatttgtcctt
agagacttacttccaaagacaaactactgtgtatctctttattttgatgatgaccccgca
ataaaatctcccttaaaatgcatcgtccttcagcctggccaggaatcaggattatcagaa
tctgctatagtaggaataactacttcgtgtttggtagtgatggttttcgtgagcactatc
gtaatgctgaaacggattggttatatatgcctaaaagacaatttgcccaatgtcttgaac
ttccgccactttttaacctggataatccctgaacggtcaccttcagaagccatcgatcgg
ctggaaatcatccccacaaacaagaagaagagactgtggaattacgattatgaggatggc
agtgacagtgacgaagaggtccccacagcaagtgtcactggctacaccatgcatggactg
acgggcaagcctctgcaacaaacctctgacacctcagccagccccgaggatcccctgcat
gaagaagattcaggcgctgaggaatctgatgaagctggagcaggggctggagctgagcca
gaactccccacagaggcgggggcggggccttcagaagaccccactggcccctatgagaga
agaaagagtgtgctcgaggactcattccccagggaggacaacagctccatggatgagcct
ggggacaacattatcttcaacgtgaacttaaactctgtgtttctgagggttctccatgat
gaagatgcctcagagacattatctctcgaagaagacaccatcctcctagacgaaggtccc
cagaggacagagtcagaccttcggatagctggtggggacaggacacagccgcccctcccc
agccttccttcccaggatctatggactgaagatgggtcatctgagaaatcagacacctca
gattccgatgctgatgtgggggacggctacatcatgagatga

DBGET integrated database retrieval system