KEGG   Mus musculus (mouse): 15978Help
Entry
15978             CDS       T01002                                 

Gene name
Ifng, IFN-g, Ifg
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu04060  Cytokine-cytokine receptor interaction
mmu04066  HIF-1 signaling pathway
mmu04217  Necroptosis
mmu04350  TGF-beta signaling pathway
mmu04380  Osteoclast differentiation
mmu04612  Antigen processing and presentation
mmu04630  Jak-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04940  Type I diabetes mellitus
mmu05132  Salmonella infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05144  Malaria
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05152  Tuberculosis
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex infection
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease (IBD)
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    15978 (Ifng)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    15978 (Ifng)
   04630 Jak-STAT signaling pathway
    15978 (Ifng)
   04066 HIF-1 signaling pathway
    15978 (Ifng)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15978 (Ifng)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15978 (Ifng)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15978 (Ifng)
   04612 Antigen processing and presentation
    15978 (Ifng)
   04660 T cell receptor signaling pathway
    15978 (Ifng)
   04658 Th1 and Th2 cell differentiation
    15978 (Ifng)
   04659 Th17 cell differentiation
    15978 (Ifng)
   04657 IL-17 signaling pathway
    15978 (Ifng)
  09158 Development
   04380 Osteoclast differentiation
    15978 (Ifng)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    15978 (Ifng)
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    15978 (Ifng)
   05323 Rheumatoid arthritis
    15978 (Ifng)
   05321 Inflammatory bowel disease (IBD)
    15978 (Ifng)
   05330 Allograft rejection
    15978 (Ifng)
   05332 Graft-versus-host disease
    15978 (Ifng)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    15978 (Ifng)
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    15978 (Ifng)
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    15978 (Ifng)
   05152 Tuberculosis
    15978 (Ifng)
  09172 Infectious diseases: Viral
   05162 Measles
    15978 (Ifng)
   05164 Influenza A
    15978 (Ifng)
   05168 Herpes simplex infection
    15978 (Ifng)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    15978 (Ifng)
   05144 Malaria
    15978 (Ifng)
   05145 Toxoplasmosis
    15978 (Ifng)
   05140 Leishmaniasis
    15978 (Ifng)
   05142 Chagas disease (American trypanosomiasis)
    15978 (Ifng)
   05143 African trypanosomiasis
    15978 (Ifng)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    15978 (Ifng)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15978 (Ifng)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    15978 (Ifng)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    15978 (Ifng)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15978 (Ifng)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Cytokines
   15978 (Ifng)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IFN-gamma
Motif
Other DBs
NCBI-GeneID: 15978
NCBI-ProteinID: NP_032363
MGI: 107656
Ensembl: ENSMUSG00000055170
UniProt: P01580
Position
10 D2; 10 66.75 cM
AA seq 155 aa AA seqDB search
MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKD
GDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFE
VNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctacacactgcatcttggctttgcagctcttcctcatggctgtttctggctgt
tactgccacggcacagtcattgaaagcctagaaagtctgaataactattttaactcaagt
ggcatagatgtggaagaaaagagtctcttcttggatatctggaggaactggcaaaaggat
ggtgacatgaaaatcctgcagagccagattatctctttctacctcagactctttgaagtc
ttgaaagacaatcaggccatcagcaacaacataagcgtcattgaatcacacctgattact
accttcttcagcaacagcaaggcgaaaaaggatgcattcatgagtattgccaagtttgag
gtcaacaacccacaggtccagcgccaagcattcaatgagctcatccgagtggtccaccag
ctgttgccggaatccagcctcaggaagcggaaaaggagtcgctgctga

DBGET integrated database retrieval system