KEGG   Mus musculus (mouse): 15979
Entry
15979             CDS       T01002                                 

Gene name
Ifngr1, CD119, IFN-g, IFN-gammaR, If, Ifgr, Ifngr, Nk, Nktar
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04066  HIF-1 signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05200  Pathways in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15979 (Ifngr1)
   04066 HIF-1 signaling pathway
    15979 (Ifngr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15979 (Ifngr1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15979 (Ifngr1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15979 (Ifngr1)
   04658 Th1 and Th2 cell differentiation
    15979 (Ifngr1)
   04659 Th17 cell differentiation
    15979 (Ifngr1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15979 (Ifngr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15979 (Ifngr1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    15979 (Ifngr1)
  09172 Infectious disease: viral
   05164 Influenza A
    15979 (Ifngr1)
   05168 Herpes simplex virus 1 infection
    15979 (Ifngr1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15979 (Ifngr1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15979 (Ifngr1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    15979 (Ifngr1)
   05140 Leishmaniasis
    15979 (Ifngr1)
   05142 Chagas disease
    15979 (Ifngr1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    15979 (Ifngr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    15979 (Ifngr1)
   04090 CD molecules [BR:mmu04090]
    15979 (Ifngr1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IFN receptor family
   15979 (Ifngr1)
CD molecules [BR:mmu04090]
 Proteins
  15979 (Ifngr1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind Cation_efflux
Other DBs
NCBI-GeneID: 15979
NCBI-ProteinID: NP_034641
MGI: 107655
Ensembl: ENSMUSG00000020009
Vega: OTTMUSG00000035345
UniProt: P15261
Position
10 A3; 10 8.49 cM
AA seq 477 aa
MGPQAAAGRMILLVVLMLSAKVGSGALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQ
NMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYA
RSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYT
VYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSK
DVCIPPFHDDRKDSIWILVVAPLTVFTVVILVFAYWYTKKNSFKRKSIMLPKSLLSVVKS
ATLETKPESKYSLVTPHQPAVLESETVICEEPLSTVTAPDSPEAAEQEELSKETKALEAG
GSTSAMTPDSPPTPTQRRSFSLLSSNQSGPCSLTAYHSRNGSDSGLVGSGSSISDLESLP
NNNSETKMAEHDPPPVRKAPMASGYDKPHMLVDVLVDVGGKESLMGYRLTGEAQELS
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgggcccgcaggcggcagctggcaggatgattctgctggtggtcctgatgctgtctgcg
aaggtcgggagtggagctttgacgagcactgaggatcctgagcctccctcggtgcctgta
ccgacgaatgttctaattaagtcttataacttgaaccctgtcgtatgctgggaataccag
aacatgtcacagactcctatttttactgtacaggtaaaggtgtattcgggttcctggact
gattcctgcaccaacatttctgatcattgttgtaatatctatgaacaaattatgtatcct
gatgtatctgcctgggccagagttaaagctaaggttggacaaaaagaatctgactatgca
cggtcaaaagagttccttatgtgcctaaagggaaaggtcgggccccctggcctggagatc
aggaggaagaaggaagaacagctctccgtcctcgtatttcaccctgaagtcgttgtgaat
ggagagagccagggaaccatgtttggtgacgggagcacctgttacacattcgactatact
gtgtatgtggagcataaccggagtggggagatcctacatacgaaacatacggtcgaaaaa
gaagagtgtaatgagactctgtgtgagttaaacatctcagtatccacactggattccaga
tattgtatttcagtagacggaatctcatctttctggcaagttagaacagaaaaatcgaaa
gacgtctgtatccctcctttccatgatgacagaaaggattcaatttggattctggtggtt
gctcctcttaccgtctttacagtagttatcctggtatttgcgtattggtatactaagaag
aattcattcaagagaaaaagcataatgttacctaagtccttgctctctgtggtaaaaagt
gccacgttagagacaaaacctgaatcgaagtattcacttgtcacaccgcaccagccagct
gtcctagagagtgagacggtgatctgtgaagagcccctgtccacagtgacagctccagac
agccccgaagcagcagaacaggaagaactttcaaaagaaacaaaggctctggaggctgga
ggaagcacgtctgccatgaccccagacagccctccaactccgacacaaagacgcagcttt
tccctgttaagtagtaaccagtcaggcccttgtagcctcaccgcctatcactcccgaaac
ggctctgacagtggcctcgtgggatcgggcagctccatatcggacttggaatctctccca
aacaacaactcagaaacaaagatggcagagcacgaccctccacccgtgagaaaggccccc
atggcctccggttatgacaaaccgcacatgttggtggacgtgcttgtggatgttgggggg
aaggagtctctcatggggtatagactcacaggagaggcccaggagctgtcctaa

KEGG   Mus musculus (mouse): 15980
Entry
15980             CDS       T01002                                 

Gene name
Ifngr2, Ifg, Ifgr2, Ifgt
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04066  HIF-1 signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05200  Pathways in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15980 (Ifngr2)
   04066 HIF-1 signaling pathway
    15980 (Ifngr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15980 (Ifngr2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15980 (Ifngr2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15980 (Ifngr2)
   04658 Th1 and Th2 cell differentiation
    15980 (Ifngr2)
   04659 Th17 cell differentiation
    15980 (Ifngr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15980 (Ifngr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15980 (Ifngr2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    15980 (Ifngr2)
  09172 Infectious disease: viral
   05164 Influenza A
    15980 (Ifngr2)
   05168 Herpes simplex virus 1 infection
    15980 (Ifngr2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15980 (Ifngr2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    15980 (Ifngr2)
   05140 Leishmaniasis
    15980 (Ifngr2)
   05142 Chagas disease
    15980 (Ifngr2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    15980 (Ifngr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    15980 (Ifngr2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IFN receptor family
   15980 (Ifngr2)
SSDB
Motif
Pfam: Tissue_fac fn3 Interfer-bind
Other DBs
NCBI-GeneID: 15980
NCBI-ProteinID: NP_032364
MGI: 107654
Ensembl: ENSMUSG00000022965
Vega: OTTMUSG00000028337
UniProt: Q63953
Position
16 C3.3; 16 53.07 cM
AA seq 332 aa
MRPLPLWLPSLLLCGLGAAASSPDSFSQLAAPLNPRLHLYNDEQILTWEPSPSSNDPRPV
VYQVEYSFIDGSWHRLLEPNCTDITETKCDLTGGGRLKLFPHPFTVFLRVRAKRGNLTSK
WVGLEPFQHYENVTVGPPKNISVTPGKGSLVIHFSPPFDVFHGATFQYLVHYWEKSETQQ
EQVEGPFKSNSIVLGNLKPYRVYCLQTEAQLILKNKKIRPHGLLSNVSCHETTANASARL
QQVILIPLGIFALLLGLTGACFTLFLKYQSRVKYWFQAPPNIPEQIEEYLKDPDQFILEV
LDKDGSPKEDSWDSVSIISSPEKERDDVLQTP
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcggcctttgccactgtggctgccgtcgctgctgctctgtgggctcggtgccgcggcg
tcctcgccagactcgttttcccagcttgcggcccctctgaacccaaggcttcacctgtac
aatgatgagcagattctaacttgggagccgtcaccttccagcaatgacccaagaccagtg
gtctaccaggtggaatatagcttcatcgatggctcttggcataggttgctggagccgaac
tgtacggacatcacagagacaaagtgtgacttaacaggaggcggccgcttgaagcttttc
ccacacccattcacagtcttcctgcgggtgcgagccaagcgagggaacctcacttccaag
tgggtggggctggagccatttcaacactatgagaatgttactgttggacctccgaaaaac
atctcggtgaccccaggaaaaggttccctcgtcatacacttctcccctccctttgatgtg
ttccacggggcaacttttcagtatcttgtccactactgggaaaagtcagaaacccaacag
gaacaggttgaaggccctttcaagagcaactccattgtgctgggcaatctgaagccatac
agagtatattgtttacaaactgaggcacaactgattttgaaaaacaaaaaaatccgacca
catgggctcttgagcaatgtatcctgtcacgaaacaacagcaaatgcctccgccaggctg
cagcaagtcatcctgattccgttgggcatcttcgcattgctgctcggcctgacgggcgcc
tgcttcaccctgttcctcaaataccaaagccgagtgaagtactggtttcaggctccgcca
aacatcccggaacaaatcgaagagtatctaaaggacccagaccaattcatcttagaggtc
ttggacaaggacggttcaccgaaggaggactcctgggactccgtgtcaattatttcttct
ccagaaaaggagcgagatgatgtgctccaaacaccgtga

DBGET integrated database retrieval system