KEGG   Mus musculus (mouse): 16004
Entry
16004             CDS       T01002                                 

Gene name
Igf2r, AI661837, CD222, CI-, CI-MPR, M6P/IG, M6P/IGF2R, Mpr3, Mpr300
Definition
(RefSeq) insulin-like growth factor 2 receptor
  KO
K06564  insulin-like growth factor 2 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16004 (Igf2r)
   04142 Lysosome
    16004 (Igf2r)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16004 (Igf2r)
CD molecules [BR:mmu04090]
 Proteins
  16004 (Igf2r)
Lectins [BR:mmu04091]
 P-type lectins
  16004 (Igf2r)
SSDB
Motif
Pfam: CIMR ATG27 Man-6-P_recep fn2 PRKCSH_1
Other DBs
NCBI-GeneID: 16004
NCBI-ProteinID: NP_034645
MGI: 96435
Ensembl: ENSMUSG00000023830
Vega: OTTMUSG00000034915
UniProt: Q07113 Q8C6V9
Position
17 A1; 17 8.64 cM
AA seq 2483 aa
MRAVQLGPVPSGPRVALLPPLLLLLLLAAAGSAQAQAVDLDALCSYTWEAVDSKNNAVYK
INVCGNVGISSCGPTSAICMCDLKTENCRSVGDSLLRSSARSLLEFNTTMGCQPSDSQHR
IQTSITFLCGKTLGTPEFVTATDCVHYFEWRTTAACKKDIFKADKEVPCYAFDDKLQKHD
LNPLIKLNGGYLVDDSDPDTSLFINVCRDIDSLRDPSTQLRVCPAGTAACLLKGNQAFDV
GRPKEGLKLLSKDRLVLTYVKEEGEKPDFCNGHSPAVTVTFVCPSERREGTIPKLTAKSN
CRYEVEWITEYACHRDYLQSESCSLSSEQHDITIDLSPLAQYGGSPYVSDGREYTFFINV
CGDTKVSLCNNKEAAVCQEKKADSTQVKIAGRHQNQTLRYSDGDLTLIYSGGDECSSGFQ
RMSVINFECNKTAGKDGRGEPVFTGEVDCTYFFTWDTKYACIKEKEDLLCGAINGKKRYD
LSVLARHSESEQNWEAVDGSQAESEKYFFINVCHRVLQEGKARNCPEDAAVCAVDKNGSK
NLGKFVSSPTKEKGHIQLSYTDGDDCGSDKKISTNITLVCKPGDLESAPVLRAARSDGCF
YEFEWHTAAACVLSKTEGENCTVLDAQAGFSFDLSLLTKKNGAYKVETEKYDFYINVCGP
VSMDPCQSNSGACQVAKSGKSWNLGLSSTKLTYYDGMIQLSYRNGTPYNNEKHTPRATLI
TFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECMVTDPSMMEQYDLSSLVKSE
GGSGGNWYAMENSREHVTRRKYYLNVCRPLNPVPGCDRYASACQMKYENHEGSLAETVSI
SNLGVAKIGPVVEESGSLLLEYVNGSACTTSDGQLTTYSTRIHLVCGRGFMNSHPIFTFN
WECVVSFLWNTEAACPIQTITETDQACSIRDPSSGFVFNLSPLNDSAQGHVVLGIGKTFV
FNICGAMPACGTVAGKPAYGCEAETQIEDIKDLRPQRPVGMERSLQLSAEGFLTLTYKGS
SPSDRGTAFIIRFICNDDIYPGAPKFLHQDIDSTRGIRNTYFEFETALACTPSLVDCQVT
DPAGNEYDLSALSMVRKPWTAVDTSAYGKRRHFYLSVCNPLPYIPGCHGIALGSCMVSED
NSFNLGVVQISPQATGNGSLSILYVNGDRCGDQRFSTRIVFECAQTSGSPMFQFVNNCEY
VFVWRTVEACPVIREEGDNCQVKDPRHGNLYDLKPLGLNDTIVSVGEYTYYLRVCGKLSS
DVCSAHDGSKAVSSCQEKKGPQGFQKVAGLLSQKLTFENGLLKMNYTGGDTCHKVYQRST
TIYFYCDRTTQKPVFLKETSDCSYMFEWRTQYACPPFNVTECSVQDAAGNSIDLSSLSRY
SDNWEAVTRTGATEHYLINVCKSLSPHAGTEPCPPEAAVCLLNGSKPVNLGKVRDGPQWT
DGVTVLQYVDGDLCPDKIRRRSTIIRFTCSDNQVNSRPLFISAVQDCEYTFSWPTPSACP
VKSNTHDDCQVTNPSTGHLFDLSSLSGRAGINASYSEKGLVFMSICEENENCGPGVGACF
GQTRISVGKASKRLSYKDQVLQLVYENGSPCPSLSDLRYKSVISFVCRPEAGPTNRPMLI
SLDKQTCTLFFSWHTPLACEQATECTVRNGSSIIDLSPLIHRTGGYEAYDESEDDTSDTT
PDFYINICQPLNPMHGVPCPAGASVCKVPVDGPPIDIGRVTGPPIFNPVANEVYLNFESS
THCLADRYMNYTSLITFHCKRGVSMGTPKLIRTNDCDFVFEWETPIVCPDEVKTQGCAVT
DEQLLYSFNLTSLSTSTFKVTRDARTYSIGVCTAAAGLGQEGCKDGGVCLLSGNKGASFG
RLASMQLDYRHQDEAVILSYVNGDPCPPETDDGEPCVFPFIYKGKSYDECVLEGRAKLWC
SKTANYDRDHEWGFCRQTNSYRMSAIIFTCDESEDIGRPQVFSEDRGCEVTFEWKTKVVC
PPKKMECKFVQKHKTYDLRLLSSLTGSWDFVHEGNSYFINLCQRVYKGPLDCSERASICK
KSATGQVQVLGLVHTQKLEVIDETVIVTYSKGYPCGGNKTASSVIELTCAKTVGRPAFKR
FDSVSCTYYFYWYSRAACAVRPQEVTMVNGTLTNPVTGKSFSLGEIYFKLFSASGDMRTN
GDNYLYEIQLSSITSSSYPACAGANICQVKPNDQHFSRKVGTSDMTKYYVQDGDLDVVFT
SSSKCGKDKTKSVSSTIFFHCDPLVKDGIPEFSHETADCQYLFSWYTSAVCPLGVDFEDE
SAGPEYKGLSERSQAVGAVLSLLLVALTGCLLALLLHKKERRETVINKLTSCCRRSSGVS
YKYSKVSKEEETDENETEWLMEEIQVPAPRLGKDGQENGHITTKAVKAEALSSLHGDDQD
SEDEVLTVPEVKVHSGRGAEVESSQPLRNPQRKVLKEREGERLGLVRGEKARKGKFRPGQ
RKPTAPAKLVSFHDDSDEDLLHI
NT seq 7452 nt   +upstreamnt  +downstreamnt
atgcgggccgttcagctgggaccggtgccctccgggccgcgcgtcgcgctcctgccgccg
ctcctgctgctgctgctcctggcggccgcgggctccgcgcaggcccaggccgtcgacttg
gacgccctgtgcagttacacatgggaagctgttgactccaaaaacaatgcagtttataag
atcaacgtctgtggaaatgtgggtatttccagctgtgggcctacaagtgctatctgtatg
tgtgacctaaagacagagaactgccgctcagtgggtgactcacttttgagaagttcagcc
agatcactcctggaattcaacaccactatgggctgccagccttcagattcacagcacaga
atccagactagcattacatttctgtgtgggaagaccctgggaactcctgaatttgtaact
gccacagactgtgtgcattactttgaatggaggactactgcagcctgcaagaaagacata
tttaaagctgataaggaggtaccatgctatgcatttgatgacaagttacagaagcatgat
ttaaacccactgatcaagctaaatggtggctatctggtagatgattctgatcctgacacg
tctctgttcatcaacgtgtgtagagacatagactcccttcgggaccccagcacacagctg
agagtctgtcctgctggcactgctgcctgtctgctgaaggggaaccaggcatttgacgtt
ggccgacccaaggaggggctgaagctgttgagcaaggacaggctcgttctgacttatgtg
aaggaagagggagaaaagccagacttctgtaatggtcacagccctgcagtgacagtaaca
tttgtgtgcccatctgagcggagagagggtaccattcctaaactcactgccaagtccaac
tgccgttatgaagttgagtggatcaccgagtatgcctgccacagagattacctgcaaagt
gagagctgctccctcagcagtgagcagcatgatattactattgaccttagtcccttggcc
caatatggagggtccccctatgtttctgatggaagagaatatacgttttttatcaatgtc
tgtggggacacaaaggtctcactctgtaataacaaagaggctgctgtttgtcaagagaaa
aaggcggattccactcaagtcaaaatagcaggaagacaccagaaccagacactccggtac
tcagatggagacctcaccctcatctattctggaggtgatgagtgtagctctggcttccag
aggatgagtgtcataaactttgagtgcaacaaaactgcaggtaaggatgggagaggagag
cctgtgttcacaggtgaggtggactgcacctacttcttcacatgggacactaaatacgcc
tgcatcaaagagaaggaagacctcctctgcggggccatcaatggcaagaaacgctatgac
ctgtctgtgttggctcgtcactcagaatcagaacagaattgggaagcagtggatggcagc
caggcagaatcagaaaagtatttcttcatcaacgtctgtcaccgggtgctgcaggagggg
aaggccaggaactgtcctgaagatgctgctgtgtgcgctgtggataagaatgggagtaaa
aaccttggaaaatttgtctcttctcctacaaaagagaaaggacacatacagctctcttac
actgatggtgatgactgtggcagtgataagaaaatatcaactaacatcacacttgtgtgc
aaaccaggtgatctagaaagtgctccagtgctaagagctgcaagatctgatggctgcttc
tatgagtttgagtggcatacggctgctgcctgtgtactgtcgaagacagaaggagagaac
tgcacggtccttgatgcccaggcagggttttcctttgatttgtcactcctcacgaagaag
aatggtgcatataaagttgagacagagaagtatgacttctacataaatgtttgtggccct
gtatccatggatccttgtcagtcaaactcgggggcctgccaggtagcgaaaagtggtaag
tcttggaacttggggctgagtagtactaagctcacctactacgacggaatgatccagctg
agctacaggaacggcactccctataacaatgaaaagcacacaccgagagccacactgatt
accttcctctgtgaccgtgacgctggagtgggcttcccagaatatcaggaagaggacaac
tctacctacaacttccggtggtacaccagttatgcctgcccagaagaacccctggagtgc
atggtgacagacccctccatgatggaacagtatgacctctccagtctagtgaagtctgaa
ggtggctctggaggaaactggtatgctatggaaaactcccgggaacatgttacacggagg
aaatactacctcaatgtgtgtcggcctctgaatcctgtgccaggctgcgatcgatatgca
tctgcttgccagatgaaatatgaaaatcatgagggctccttggcagagactgtatccatc
agtaacttgggagttgcaaagataggccctgtggtggaggagagtggcagcctcctctta
gagtatgtgaacggctctgcttgcaccaccagtgatggccagctcaccacctacagcacc
aggatccatcttgtctgtggtcgaggatttatgaactcccatcccatattcactttcaac
tgggaatgtgtggtcagtttcttgtggaacacggaggctgcctgccctatccagacaatc
acagaaacagaccaggcttgctcaataagggaccccagcagtgggtttgtgtttaatctt
agcccactcaacgattctgctcaaggacatgtggtcttaggcatcggaaagacttttgtg
ttcaatatctgtggtgcaatgcctgcctgtggaacggttgcggggaagccagcctatggc
tgcgaggccgaaactcagatagaagatattaaggacctaaggccacaaaggccggtcggg
atggagaggagcctccagttgtctgccgagggattcctcactctgacctacaagggctct
tctccctctgacagaggcacagcattcatcatccgttttatttgcaacgatgacatttac
ccaggagcccccaaattcctgcatcaggacattgactccacacgagggatccggaacact
tactttgagtttgaaactgcattggcttgtactccttctctagtggattgtcaagtgact
gacccagctgggaacgagtatgacttgagcgccctgagcatggtcaggaagccatggact
gccgtggacacgtctgcatacgggaagaggaggcacttctacctgagtgtctgcaaccct
ctgccttatatccctggctgccacggcattgcattggggtcctgcatggtgtcagaagac
aacagttttaacttgggtgtggtgcagatcagtcctcaagctactggaaatgggtctctc
agcatcctgtacgtgaatggggacagatgtggggaccagcgcttctccaccaggatcgtg
ttcgagtgtgcccagacgtcgggctcacctatgttccagttcgtgaacaactgtgagtat
gtgtttgtgtggcgaacagtggaggcctgccctgtgatcagagaggaaggagacaactgc
caggtgaaggaccccaggcatggcaatttgtatgacctgaagcccctgggcctcaatgac
accatcgtcagtgttggcgagtacacctactacttgcgggtctgcgggaagctgtcatca
gatgtctgctctgcccatgacggatccaaggcagtctcatcatgccaggaaaagaaagga
ccacagggattccagaaagtggcaggactccttagccagaagctgactttcgaaaacgga
ctgttgaaaatgaactatactgggggggatacctgccataaggtgtatcagcgctccaca
accatctatttctactgtgaccggactacacagaagccagtgtttctgaaggaaacttcg
gactgctcctatatgtttgagtggcgaacacagtatgcctgcccacctttcaatgtgaca
gagtgttctgtccaggatgcggctggcaactccattgacctctcctcactgtcaaggtac
agtgacaactgggaggctgtgaccaggacaggggccactgagcattacctcatcaatgta
tgcaagtctctgtctccacacgctggcacagagccatgccctccagaggcagctgtttgt
ctgctgaatggctctaagcctgtgaaccttggcaaggtgagggatggccctcagtggaca
gacggtgtgactgtcctgcagtatgtggatggtgacttgtgcccagacaaaattcggaga
aggtcaaccattattcgcttcacctgcagtgacaaccaagtgaactccaggccccttttc
atcagtgctgttcaggactgtgagtacaccttctcctggcccaccccttctgcctgtcct
gtgaagagcaacacacatgatgactgccaagtcaccaaccccagcacaggccacctgttt
gacctgagctccttaagtggcagagctggtatcaatgcctcctacagcgagaaggggctg
gtcttcatgagcatctgtgaggagaatgagaactgtggccccggagtaggggcctgcttt
ggacagacgaggatcagtgtgggcaaggccagcaagaggctgagctacaaggaccaagtc
ctgcagctggtgtatgagaatgggtccccatgcccttccctgtcagacctgaggtacaag
agtgtcatcagctttgtgtgccggcctgaggctggacctaccaacaggccgatgctcatc
tccttggacaagcagacgtgcacactcttcttctcctggcacacacccctggcctgtgag
caagcgacggagtgtactgtgcggaatggaagctcgattattgacctgtcccctctcatc
caccgcactggtggctacgaagcatacgatgaaagtgaggatgacacctctgacaccacc
cctgacttctatatcaacatctgccagccactgaatcccatgcacggagtgccctgccct
gcaggtgcctcagtatgcaaagttcctgtggacgggccccctatagatattggcagagtc
acaggccctccaatattcaatcctgtggcgaatgaagtctacctgaactttgagagcagc
actcattgcttagccgacagatatatgaactacacctcactcatcacatttcactgcaag
agaggagtcagcatgggaactcctaagctgataaggaccaatgactgcgactttgtgttt
gagtgggagactccgattgtctgtcctgacgaagtgaagacacagggttgtgctgtaaca
gatgagcagctgctctatagcttcaacctgaccagcctttccacaagcactttcaaggtt
actcgggatgcccgcacatacagtataggggtgtgcacagcagcagctggcttaggccag
gaaggctgcaaggatggcggtgtctgtctgctctctgggaacaaaggagcttcttttggg
cgccttgcatcgatgcagctggattacaggcaccaagatgaagcagtcattctgagttat
gtgaatggtgatccttgccctccagaaacggatgatggcgagccctgtgtcttccccttc
atttacaaagggaagagctatgatgaatgtgtattagagggacgagcgaaactgtggtgt
agcaaaactgcaaattatgatcgtgaccacgagtggggcttctgcagacagaccaacagc
taccggatgtctgcgatcatatttacgtgtgatgaaagtgaagatattgggagaccacaa
gtgttcagtgaagatcgtgggtgtgaggtgacatttgagtggaagacaaaagttgtctgc
cctccaaagaagatggagtgcaagtttgttcagaagcataagacctatgacttgcgactg
ctctcatccctcacggggtcctgggactttgtgcatgaaggaaactcgtactttatcaat
ctgtgccaaagagtatacaaaggtcccctggactgctctgaaagagccagcatttgcaag
aagagtgccactggtcaagtccaggttttggggcttgttcatacacaaaaattggaagtc
atagatgaaacggtcattgttacttactcgaaaggctatccttgtggtgggaataagact
gcatcgtctgtaatcgaattgacctgtgcgaagactgtgggcaggcctgcattcaagagg
tttgacagtgtcagctgcacctactacttttactggtactcacgggctgcctgcgcggtg
aggcctcaggaggtgaccatggtgaacggaacgctcaccaaccctgtgaccggcaagagc
ttcagcctcggcgagatttattttaagctcttcagcgcctctggagacatgaggaccaat
ggggacaactacctgtatgaaatccagctctcctccatcaccagctcttcttaccctgca
tgcgctggtgccaacatctgccaggtgaagcccaatgaccagcatttcagcaggaaagta
ggcacctctgacatgaccaagtactacgtccaagatggagatctggatgtggtgtttacc
tcttcctccaagtgtgggaaagataagaccaagtctgtttcttccaccatcttcttccac
tgtgaccctctggtgaaggatgggatcccagagttcagccacgagaccgctgactgccag
tacctgttctcctggtacacttcagctgtgtgtcctctgggtgtggactttgaggatgag
agcgcagggccagagtataaaggactctcagagcggagtcaggctgttggggcagtcctc
agtcttctcctggtggcgctgactggctgcttgctggccttactgctgcataagaaggag
agaagggaaactgtgataaacaagctgaccagctgctgcagaagaagctcgggcgtgtcc
tacaagtactcaaaggtcagcaaggaggaggagacagatgagaatgagacagaatggctg
atggaagagatccaggtgccagccccaagactaggcaaggacgggcaagaaaatggccat
atcaccaccaaggcggtgaaagcagaagctctctcgtccctgcatggggacgaccaggac
agtgaggatgaggtcctgaccgttccagaggtgaaagttcactcaggccgaggagcggag
gtggaaagctcacagcccctgagaaacccacagcgcaaggtcctgaaggaaagggagggt
gagaggctggggctggtccgaggtgagaaggccagaaaagggaagttcagacccggacag
cgcaagccaacagcccctgccaagctggtgtccttccatgatgacagcgacgaagacctc
ttacacatctaa

DBGET integrated database retrieval system