KEGG   Mus musculus (mouse): 16006Help
Entry
16006             CDS       T01002                                 

Gene name
Igfbp1
Definition
(RefSeq) insulin-like growth factor binding protein 1
  KO
K23578  insulin-like growth factor-binding protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16006 (Igfbp1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    16006 (Igfbp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thyroglobulin_1 IGFBP DUF1566
Motif
Other DBs
NCBI-GeneID: 16006
NCBI-ProteinID: NP_032367
MGI: 96436
Ensembl: ENSMUSG00000020429
Vega: OTTMUSG00000005136
UniProt: P47876
Position
11 A1; 11 4.75 cM
AA seq 272 aa AA seqDB search
MPEFLTVVSWPFLILLSFQIGVAAGAPQPWHCAPCTAERLGLCPPVPASCPEISRPAGCG
CCPTCALPMGAACGVATARCAQGLSCRALPGEPRPLHALTRGQGACVPEPAAPATSTLFS
SQHEEAKAAVVSADELSESPEMTEEQLLDSFHLMAPSREDQPILWNAISTYSSMRAREIA
DLKKWKEPCQRELYKVLERLAAAQQKAGDEIYKFYLPNCNKNGFYHSKQCETSLDGEAGL
CWCVYPWSGKKIPGSLETRGDPNCHQYFNVHN
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagttcctaactgttgtttcttggccgttcctgattctcctgtccttccagatt
ggcgtggccgctggagccccccagccatggcactgtgctccctgcactgctgagaggctg
gggctctgtccacccgtgcccgcttcgtgccccgagatttctcggcctgcaggctgtggc
tgctgcccgacatgtgccttgccgatgggtgctgcctgcggtgtggccactgctcgctgc
gcccagggactcagctgccgtgcgttgccaggagagcctcgtcccctgcatgccctcacc
cgtggtcagggagcctgtgtaccagaacctgctgcacccgccacgagcaccttgttcagc
tcccagcatgaagaggcaaaggctgctgtggtctccgcggatgagctttctgagagccca
gagatgacagaggagcagctgctggacagcttccacctgatggccccatcccgcgaggat
cagcccatcctgtggaacgccatcagcacctatagcagcatgcgggcccgggagatcgcc
gacctcaagaaatggaaggagccctgccaacgagaactctataaagtgctagagagatta
gctgcagcccaacagaaagcaggagatgaaatctacaaattttatctgccaaactgcaac
aagaatggattttatcacagcaaacagtgtgagacatccctggatggagaagctggactc
tgctggtgtgtctacccatggagtggaaagaaaatccctgggtctctggagactagaggg
gaccccaactgccaccagtattttaatgtacataactga

DBGET integrated database retrieval system