KEGG   Mus musculus (mouse): 16011
Entry
16011             CDS       T01002                                 

Gene name
Igfbp5, AI256729, AW208790, IGFBP-5, IGFBP-5P
Definition
(RefSeq) insulin-like growth factor binding protein 5
  KO
K23577  insulin-like growth factor-binding protein 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16011 (Igfbp5)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    16011 (Igfbp5)
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 16011
NCBI-ProteinID: NP_034648
MGI: 96440
Ensembl: ENSMUSG00000026185
Vega: OTTMUSG00000017306
UniProt: Q07079 Q3UQV0
Position
1 C3; 1 36.94 cM
AA seq 271 aa
MVISVVLLLLAAYAVPAQGLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCAL
AEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYGEQTKIERDSREHEE
PTTSEMAEETYSPKVFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRVIPAP
EMRQESEQGPCRRHMEASLQEFKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGIC
WCVDKYGMKLPGMEYVDGDFQCHAFDSSNVE
NT seq 816 nt   +upstreamnt  +downstreamnt
atggtgatcagcgtggtcctcctgctgctggccgcctatgccgtaccggctcaaggcctg
ggttctttcgtgcactgtgaaccctgcgacgagaaagctctgtccatgtgtccccccagc
cctctgggctgtgagctggtcaaagagcccggctgtggctgctgcatgacttgcgccctg
gcggagggacagtcgtgtggcgtctacacggagcgctgcgcccagggtttgcgctgcctc
ccccggcaggatgaggagaagccgctgcacgccctgctgcacggccgcggggtttgcctc
aacgaaaagagctacggcgagcaaaccaagatagagagagactctcgggaacacgaggaa
cccaccacctccgagatggctgaagagacctactcccccaaggtcttccggcccaagcac
actcgcatttccgagctgaaggctgaggctgtgaagaaggaccgcagaaagaagctgacc
cagtccaagtttgtggggggtgcagagaacactgcccaccccagagtcatccctgcacct
gagatgagacaggaatccgaacaaggcccctgccgcagacacatggaagcttccctccag
gagttcaaagccagcccacgcatggtgccccgtgctgtgtacctgcccaactgtgaccgc
aaaggattctacaagagaaagcagtgtaagccctcccgtggccgcaaacgtggcatctgc
tggtgtgtggacaagtacggaatgaagctgccgggcatggagtacgtggatggggacttt
cagtgccacgccttcgacagcagtaacgttgagtga

DBGET integrated database retrieval system