KEGG   Mus musculus (mouse): 16069Help
Entry
16069             CDS       T01002                                 

Gene name
Jchain, 9530090F24Rik, AI323815, Igj, Jch
Definition
(RefSeq) immunoglobulin joining chain
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_J_chain RTP1_C1
Motif
Other DBs
NCBI-GeneID: 16069
NCBI-ProteinID: NP_690052
MGI: 96493
Ensembl: ENSMUSG00000067149
Vega: OTTMUSG00000036864
UniProt: P01592
Position
5; 5 E1
AA seq 159 aa AA seqDB search
MKTHLLLWGVLAIFVKAVLVTGDDEATILADNKCMCTRVTSRIIPSTEDPNEDIVERNIR
IVVPLNNRENISDPTSPLRRNFVYHLSDVCKKCDPVEVELEDQVVTATQSNICNEDDGVP
ETCYMYDRNKCYTTMVPLRYHGETKMVQAALTPDSCYPD
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaagacccacctgcttctctggggagtcctggccatttttgttaaggctgtccttgta
acaggtgacgacgaagcgaccattcttgctgacaacaaatgcatgtgtacccgagttacc
tctaggatcatcccttccaccgaggatcctaatgaggacattgtggagagaaatatccga
attgttgtccctttgaacaacagggagaatatctctgatcccacctccccactgagaagg
aactttgtataccatttgtcagacgtctgtaagaaatgcgatcctgtggaagtggagctg
gaagatcaggttgttactgccacccagagcaacatctgcaatgaagacgatggtgttcct
gagacctgctacatgtatgacagaaacaagtgctataccactatggtcccacttaggtat
catggtgagaccaaaatggtgcaagcagccttgacccccgattcttgctaccctgactag

DBGET integrated database retrieval system