KEGG   Mus musculus (mouse): 16136
Entry
16136             CDS       T01002                                 

Gene name
Igll1, BB139905, Igl-5, Igll, Lambda5
Definition
(RefSeq) immunoglobulin lambda-like polypeptide 1
  KO
K06554  immunoglobulin lambda-like polypeptide 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    16136 (Igll1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16136 (Igll1)
CD molecules [BR:mmu04090]
 Proteins
  16136 (Igll1)
SSDB
Motif
Pfam: C1-set ig Ig_3 C2-set_2 I-set
Other DBs
NCBI-GeneID: 16136
NCBI-ProteinID: NP_001177254
MGI: 96529
Ensembl: ENSMUSG00000075370
Vega: OTTMUSG00000025624
UniProt: P20764
Position
16 A3; 16 10.45 cM
AA seq 209 aa
MKLRVGQTLGTIPRQCEVLLLLLLLGLVDGVHHILSPSSAERSRAVGPGASVGSNRPSLW
ALPGRLLFQIIPRGAGPRCSPHRLPSKPQFWYVFGGGTQLTILGQPKSDPLVTLFLPSLK
NLQANKATLVCLVSEFYPGTLVVDWKVDGVPVTQGVETTQPSKQTNNKYMVSSYLTLISD
QWMPHSRYSCRVTHEGNTVEKSVSPAECS
NT seq 630 nt   +upstreamnt  +downstreamnt
atgaagctcagagtaggacagactctgggcactatccccaggcagtgtgaagttctcctc
ctgctgctgctgttgggtctagtggatggtgtccaccacatactttccccaagctcagca
gaaaggagcagagctgtgggccctggagcttcagtgggaagcaacaggcctagcctatgg
gcccttcccggcaggctcctgttccagatcatcccacggggagcaggtcccaggtgctcg
ccccataggcttccatctaagccccagttttggtatgtctttggtggtgggacccagctc
acaatcctaggtcagcccaagtctgaccccttggtcactctgttcctgccttccttaaag
aatcttcaggccaacaaggccacactagtgtgtttggtgagcgaattctacccaggtact
ttggtggtggactggaaggtagatggggtccctgtcactcagggtgtagagacaacccaa
ccctccaaacagaccaacaacaaatacatggtcagcagctacctgacactgatatctgac
cagtggatgcctcacagtagatacagctgccgggtcactcatgaaggaaacactgtggag
aagagtgtgtcacctgctgagtgttcttag

DBGET integrated database retrieval system