KEGG   Mus musculus (mouse): 16147
Entry
16147             CDS       T01002                                 

Gene name
Ihh, HHG-2
Definition
(RefSeq) Indian hedgehog
  KO
K11989  indian hedgehog
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04340  Hedgehog signaling pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    16147 (Ihh)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    16147 (Ihh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    16147 (Ihh)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C46: hedgehog family
   16147 (Ihh)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Other DBs
NCBI-GeneID: 16147
NCBI-ProteinID: NP_034674
MGI: 96533
Ensembl: ENSMUSG00000006538
Vega: OTTMUSG00000048255
UniProt: P97812 Q80XI9
Position
1 C4; 1 38.55 cM
AA seq 411 aa
MSPAWLRPRLRFCLFLLLLLLVPAARGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKT
LGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMN
QWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYY
ESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLENGERVALSAVKPGDRVLAMGEDGTPTF
SDVLIFLDREPNRLRAFQVIETQDPPRRLALTPAHLLFIADNHTEPAAHFRATFASHVQP
GQYVLVSGVPGLQPARVAAVSTHVALGSYAPLTRHGTLVVEDVVASCFAAVADHHLAQLA
FWPLRLFPSLAWGSWTPSEGVHWYPQMLYRLGRLLLEESTFHPLGMSGAGS
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgtctcccgcctggctccggccccgactgcggttctgtctgttcctgctgctgctgctt
ctggtgccggcggcgcggggctgcgggccgggccgggtggtgggcagccgccggaggccg
cctcgcaagctcgtgcctcttgcctacaagcagttcagccccaacgtgccggagaagacc
ctgggcgccagcgggcgctacgaaggcaagatcgcgcgcagctctgagcgcttcaaagag
ctcacccccaactacaatcccgacatcatcttcaaggacgaggagaacacgggtgccgac
cgcctcatgacccagcgctgcaaggaccgtctgaactcactggccatctctgtcatgaac
cagtggcctggtgtgaaactgcgggtgaccgaaggctgggatgaagatggccatcactca
gaggagtctttacactatgagggccgcgcggtggatatcaccacctcagaccgtgaccga
aataagtatggactgctggcgcgcttagcagtggaggccggcttcgactgggtgtattac
gagtccaaggcccacgtgcattgctctgtcaagtctgagcattcggccgctgccaagaca
ggtggctgctttcctgccggagcccaggtgcgcctagagaacggggagcgtgtggccctg
tcagctgtaaagccaggagaccgggtgctggccatgggggaggatgggacccccaccttc
agtgatgtgcttattttcctggaccgcgagccaaaccggctgagagctttccaggtcatc
gagactcaggatcctccgcgtcggctggcgctcacgcctgcccacctgctcttcattgcg
gacaatcatacagaaccagcagcccacttccgggccacatttgccagccatgtgcaacca
ggccaatatgtgctggtatcaggggtaccaggcctccagcctgctcgggtggcagctgtc
tccacccacgtggcccttgggtcctatgctcctctcacaaggcatgggacacttgtggtg
gaggatgtggtggcctcctgctttgcagctgtggctgaccaccatctggctcagttggcc
ttctggcccctgcgactgtttcccagtttggcatggggcagctggaccccaagtgagggt
gttcactggtaccctcagatgctctaccgcctggggcgtctcttgctagaagagagcacc
ttccatccactgggcatgtctggggcaggaagctga

DBGET integrated database retrieval system