KEGG   Mus musculus (mouse): 16149
Entry
16149             CDS       T01002                                 

Gene name
Cd74, C, CLIP, DHLAG, HLADG, Ia-GAMMA, Ii
Definition
(RefSeq) CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)
  KO
K06505  CD74 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu05152  Tuberculosis
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    16149 (Cd74)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    16149 (Cd74)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    16149 (Cd74)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16149 (Cd74)
   00535 Proteoglycans [BR:mmu00535]
    16149 (Cd74)
CD molecules [BR:mmu04090]
 Proteins
  16149 (Cd74)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Others
   16149 (Cd74)
SSDB
Motif
Pfam: MHC2-interact MHCassoc_trimer Thyroglobulin_1
Other DBs
NCBI-GeneID: 16149
NCBI-ProteinID: NP_001036070
MGI: 96534
Ensembl: ENSMUSG00000024610
UniProt: P04441 Q545Y5 Q3U4Q8
Position
18 E1; 18 34.41 cM
AA seq 279 aa
MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLAGQATTAYFLYQQQGR
LDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNM
TQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSL
EEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNG
TEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL
NT seq 840 nt   +upstreamnt  +downstreamnt
atggatgaccaacgcgacctcatctctaaccatgaacagttgcccatactgggcaaccgc
cctagagagccagaaaggtgcagccgtggagctctgtacaccggtgtctctgtcctggtg
gctctgctcttggctgggcaggccaccactgcttacttcctgtaccagcaacagggccgc
ctagacaagctgaccatcacctcccagaacctgcaactggagagccttcgcatgaagctt
ccgaaatctgccaaacctgtgagccagatgcggatggctactcccttgctgatgcgtcca
atgtccatggataacatgctccttgggcctgtgaagaacgttaccaagtacggcaacatg
acccaggaccatgtgatgcatctgctcacgaggtctggacccctggagtacccgcagctg
aaggggaccttcccagagaatctgaagcatcttaagaactccatggatggcgtgaactgg
aagatcttcgagagctggatgaagcagtggctcttgtttgagatgagcaagaactccctg
gaggagaagaagcccaccgaggctccacctaaagtactgaccaagtgccaggaagaagtc
agccacatccctgccgtctacccgggtgcgttccgtcccaagtgcgacgagaacggtaac
tatttgccactccagtgccacgggagcactggctactgctggtgtgtgttccccaacggc
actgaggttcctcacaccaagagccgcgggcgccataactgcagtgagccactggacatg
gaagacctatcttctggcctgggagtgaccaggcaggaactgggtcaagtcaccctgtga

DBGET integrated database retrieval system