KEGG   Mus musculus (mouse): 16153
Entry
16153             CDS       T01002                                 

Gene name
Il10, CSIF, IL-, Il-10
Definition
(RefSeq) interleukin 10
  KO
K05443  interleukin 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04068  FoxO signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05143  African trypanosomiasis
mmu05144  Malaria
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease
mmu05322  Systemic lupus erythematosus
mmu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16153 (Il10)
   04068 FoxO signaling pathway
    16153 (Il10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16153 (Il10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16153 (Il10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    16153 (Il10)
   04660 T cell receptor signaling pathway
    16153 (Il10)
   04672 Intestinal immune network for IgA production
    16153 (Il10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    16153 (Il10)
   05322 Systemic lupus erythematosus
    16153 (Il10)
   05320 Autoimmune thyroid disease
    16153 (Il10)
   05321 Inflammatory bowel disease
    16153 (Il10)
   05330 Allograft rejection
    16153 (Il10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    16153 (Il10)
   05133 Pertussis
    16153 (Il10)
   05150 Staphylococcus aureus infection
    16153 (Il10)
   05152 Tuberculosis
    16153 (Il10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16153 (Il10)
   05144 Malaria
    16153 (Il10)
   05145 Toxoplasmosis
    16153 (Il10)
   05140 Leishmaniasis
    16153 (Il10)
   05142 Chagas disease
    16153 (Il10)
   05143 African trypanosomiasis
    16153 (Il10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16153 (Il10)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16153 (Il10)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16153 (Il10)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Cytokines
   16153 (Il10)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 16153
NCBI-ProteinID: NP_034678
MGI: 96537
Ensembl: ENSMUSG00000016529
Vega: OTTMUSG00000016630
UniProt: P18893 Q3U879
Structure
PDB: 
4X51

Position
1 E4; 1 56.89 cM
AA seq 178 aa
MPGSALLCCLLLLTGMRISRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQ
LDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLR
MRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcctggctcagcactgctatgctgcctgctcttactgactggcatgaggatcagcagg
ggccagtacagccgggaagacaataactgcacccacttcccagtcggccagagccacatg
ctcctagagctgcggactgccttcagccaggtgaagactttctttcaaacaaaggaccag
ctggacaacatactgctaaccgactccttaatgcaggactttaagggttacttgggttgc
caagccttatcggaaatgatccagttttacctggtagaagtgatgccccaggcagagaag
catggcccagaaatcaaggagcatttgaattccctgggtgagaagctgaagaccctcagg
atgcggctgaggcgctgtcatcgatttctcccctgtgaaaataagagcaaggcagtggag
caggtgaagagtgattttaataagctccaagaccaaggtgtctacaaggccatgaatgaa
tttgacatcttcatcaactgcatagaagcatacatgatgatcaaaatgaaaagctaa

DBGET integrated database retrieval system