KEGG   Mus musculus (mouse): 16155
Entry
16155             CDS       T01002                                 

Gene name
Il10rb, 6620401D04Rik, AI528744, CRF2-4, Crfb4, D16H21S58, D21S58h, IL-10R2, Il10r2
Definition
(RefSeq) interleukin 10 receptor, beta
  KO
K05135  interleukin 10 receptor beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04630  JAK-STAT signaling pathway
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16155 (Il10rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16155 (Il10rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16155 (Il10rb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    16155 (Il10rb)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    16155 (Il10rb)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    16155 (Il10rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16155 (Il10rb)
   04090 CD molecules [BR:mmu04090]
    16155 (Il10rb)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL10/28 receptor family
   16155 (Il10rb)
CD molecules [BR:mmu04090]
 Proteins
  16155 (Il10rb)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 Pur_ac_phosph_N DUF3139 zf-MIZ HemY_N
Other DBs
NCBI-GeneID: 16155
NCBI-ProteinID: NP_032375
MGI: 109380
Ensembl: ENSMUSG00000022969
Vega: OTTMUSG00000028329
UniProt: Q8VHM7
Position
16 C3.3; 16 52.87 cM
AA seq 351 aa
MSWAPSVAGWLGGFLLVPALGMIPPPEKVRMNSVNFKNILQWEVPAFPKTNLTFTAQYES
YRSFQDHCKRTASTQCDFSHLSKYGDYTVRVRAELADEHSEWVNVTFCPVEDTIIGPPEM
QIESLAESLHLRFSAPQIENEPETWTLKNIYDSWAYRVQYWKNGTNEKFQVVSPYDSEVL
RNLEPWTTYCIQVQGFLLDQNRTGEWSEPICERTGNDEITPSWIVAIILIVSVLVVFLFL
LGCFVVLWLIYKKTKHTFRSGTSLPQHLKEFLGHPHHSTFLLFSFPPPEEAEVFDKLSII
SEESEGSKQSPEDNCASEPPSDPGPRELESKDEAPSPPHDDPKLLTSTSEV
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtcctgggcgccgagcgtggcgggctggctgggtggcttccttctggtgccagctcta
ggaatgattccaccccctgagaaggtcagaatgaattcagttaatttcaagaacattcta
cagtgggaggtacctgctttccccaaaacgaacctgactttcacagctcagtatgaaagt
tacaggtctttccaagatcactgcaagcgcactgcctcgactcagtgcgacttctctcat
ctttctaaatacggagactacactgtgagagtcagggctgaattggcggatgaacattcg
gagtgggtcaatgtcaccttctgccccgtggaagacaccatcattggacctcctgagatg
cagatagaatcccttgctgagtctttacacctgcgtttctcagccccacaaattgagaat
gagcctgagacgtggaccttgaagaacatttatgactcatgggcttacagagtgcaatac
tggaaaaatgggactaatgagaagtttcaagttgtgtctccgtacgactctgaggtcctc
cggaacctggagccgtggacaacttactgcattcaagttcaagggtttcttctcgaccag
aacagaacaggagagtggagtgaacccatctgtgaacggacaggcaatgacgaaataacc
ccttcctggattgtggccatcatcctcatagtctccgtcctggtggtcttcctcttcctc
ctgggctgctttgtcgtgctgtggctcatttataagaagaccaagcataccttccgttct
gggacgtctcttccacagcacctgaaggagtttctgggccacccccatcacagcacgttt
ctgctgttctccttccctccccccgaggaggccgaggtgttcgacaaactaagcatcatc
agcgaagagtctgaaggcagcaagcagagtcctgaagacaactgtgcctcagagcccccg
tctgatccagggcctcgggagctggagtccaaggatgaagctccctcacctccacacgat
gaccccaaactgctcacgtcgacctcagaagtatga

DBGET integrated database retrieval system