KEGG   Mus musculus (mouse): 16160Help
Entry
16160             CDS       T01002                                 

Gene name
Il12b, Il-12b, Il-12p40, Il12p40, p40
Definition
(RefSeq) interleukin 12b
  KO
K05425  interleukin 12B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04620  Toll-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04940  Type I diabetes mellitus
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05152  Tuberculosis
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05321  Inflammatory bowel disease (IBD)
mmu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16160 (Il12b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16160 (Il12b)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    16160 (Il12b)
   04622 RIG-I-like receptor signaling pathway
    16160 (Il12b)
   04625 C-type lectin receptor signaling pathway
    16160 (Il12b)
   04658 Th1 and Th2 cell differentiation
    16160 (Il12b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16160 (Il12b)
   05205 Proteoglycans in cancer
    16160 (Il12b)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    16160 (Il12b)
   05330 Allograft rejection
    16160 (Il12b)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    16160 (Il12b)
  09171 Infectious disease: bacterial
   05133 Pertussis
    16160 (Il12b)
   05134 Legionellosis
    16160 (Il12b)
   05152 Tuberculosis
    16160 (Il12b)
  09172 Infectious disease: viral
   05162 Measles
    16160 (Il12b)
   05164 Influenza A
    16160 (Il12b)
   05168 Herpes simplex virus 1 infection
    16160 (Il12b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16160 (Il12b)
   05145 Toxoplasmosis
    16160 (Il12b)
   05140 Leishmaniasis
    16160 (Il12b)
   05142 Chagas disease (American trypanosomiasis)
    16160 (Il12b)
   05143 African trypanosomiasis
    16160 (Il12b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16160 (Il12b)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16160 (Il12b)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16160 (Il12b)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Cytokines
   16160 (Il12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL12p40_C Ig_3 Ig_5 Ig_2 fn3 Ig_4 I-set
Motif
Other DBs
NCBI-GeneID: 16160
NCBI-ProteinID: NP_001290173
MGI: 96540
Ensembl: ENSMUSG00000004296
Vega: OTTMUSG00000005468
UniProt: P43432 Q3ZAX5
Position
11 B1.1; 11 25.94 cM
AA seq 335 aa AA seqDB search
MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITW
TSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNF
KNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLD
QRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQ
MKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTS
TEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcctcagaagctaaccatctcctggtttgccatcgttttgctggtgtctccactc
atggccatgtgggagctggagaaagacgtttatgttgtagaggtggactggactcccgat
gcccctggagaaacagtgaacctcacctgtgacacgcctgaagaagatgacatcacctgg
acctcagaccagagacatggagtcataggctctggaaagaccctgaccatcactgtcaaa
gagtttctagatgctggccagtacacctgccacaaaggaggcgagactctgagccactca
catctgctgctccacaagaaggaaaatggaatttggtccactgaaattttaaaaaatttc
aaaaacaagactttcctgaagtgtgaagcaccaaattactccggacggttcacgtgctca
tggctggtgcaaagaaacatggacttgaagttcaacatcaagagcagtagcagttcccct
gactctcgggcagtgacatgtggaatggcgtctctgtctgcagagaaggtcacactggac
caaagggactatgagaagtattcagtgtcctgccaggaggatgtcacctgcccaactgcc
gaggagaccctgcccattgaactggcgttggaagcacggcagcagaataaatatgagaac
tacagcaccagcttcttcatcagggacatcatcaaaccagacccgcccaagaacttgcag
atgaagcctttgaagaactcacaggtggaggtcagctgggagtaccctgactcctggagc
actccccattcctacttctccctcaagttctttgttcgaatccagcgcaagaaagaaaag
atgaaggagacagaggaggggtgtaaccagaaaggtgcgttcctcgtagagaagacatct
accgaagtccaatgcaaaggcgggaatgtctgcgtgcaagctcaggatcgctattacaat
tcctcatgcagcaagtgggcatgtgttccctgcagggtccgatcctag

DBGET integrated database retrieval system