KEGG   Mus musculus (mouse): 16162Help
Entry
16162             CDS       T01002                                 

Gene name
Il12rb2, A930027I18Rik, IL-12RB2, Ifnm
Definition
(RefSeq) interleukin 12 receptor, beta 2
  KO
K05064  interleukin 12 receptor beta-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  Jak-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16162 (Il12rb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16162 (Il12rb2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16162 (Il12rb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16162 (Il12rb2)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    16162 (Il12rb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16162 (Il12rb2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   16162 (Il12rb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Lep_receptor_Ig Tissue_fac Pur_ac_phosph_N IL6Ra-bind ObR_Ig DUF1035
Motif
Other DBs
NCBI-GeneID: 16162
NCBI-ProteinID: NP_032380
MGI: 1270861
Ensembl: ENSMUSG00000018341
Vega: OTTMUSG00000029293
UniProt: P97378
Position
6 C1; 6 30.81 cM
AA seq 874 aa AA seqDB search
MAQTVRECSLALLFLFMWLLIKANIDVCKLGTVTVQPAPVIPLGSAANISCSLNPKQGCS
HYPSSNELILLKFVNDVLVENLHGKKVHDHTGHSSTFQVTNLSLGMTLFVCKLNCSNSQK
KPPVPVCGVEISVGVAPEPPQNISCVQEGENGTVACSWNSGKVTYLKTNYTLQLSGPNNL
TCQKQCFSDNRQNCNRLDLGINLSPDLAESRFIVRVTAINDLGNSSSLPHTFTFLDIVIP
LPPWDIRINFLNASGSRGTLQWEDEGQVVLNQLRYQPLNSTSWNMVNATNAKGKYDLRDL
RPFTEYEFQISSKLHLSGGSWSNWSESLRTRTPEEEPVGILDIWYMKQDIDYDRQQISLF
WKSLNPSEARGKILHYQVTLQEVTKKTTLQNTTRHTSWTRVIPRTGAWTASVSAANSKGA
SAPTHINIVDLCGTGLLAPHQVSAKSENMDNILVTWQPPKKADSAVREYIVEWRALQPGS
ITKFPPHWLRIPPDNMSALISENIKPYICYEIRVHALSESQGGCSSIRGDSKHKAPVSGP
HITAITEKKERLFISWTHIPFPEQRGCILHYRIYWKERDSTAQPELCEIQYRRSQNSHPI
SSLQPRVTYVLWMTAVTAAGESPQGNEREFCPQGKANWKAFVISSICIAIITVGTFSIRY
FRQKAFTLLSTLKPQWYSRTIPDPANSTWVKKYPILEEKIQLPTDNLLMAWPTPEEPEPL
IIHEVLYHMIPVVRQPYYFKRGQGFQGYSTSKQDAMYIANPQATGTLTAETRQLVNLYKV
LESRDPDSKLANLTSPLTVTPVNYLPSHEGYLPSNIEDLSPHEADPTDSFDLEHQHISLS
IFASSSLRPLIFGGERLTLDRLKMGYDSLMSNEA
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atggcacagactgttagagaatgctcattggcacttctttttttgttcatgtggctgctg
attaaagcaaatatagatgtgtgcaagcttggcactgtgaccgtccagcctgcccctgtg
attcctcttgggtcagctgccaatatttcctgctccttgaatcccaagcaaggctgttca
cattatcccagttctaacgaattaatcctcttaaagtttgtcaatgatgtccttgttgaa
aatctccatggcaagaaagtccatgaccacactggtcactcctccacttttcaagtcacc
aacctgtcccttggtatgaccttgtttgtctgcaagctaaactgtagcaactctcaaaag
aagccaccagtcccagtatgtggggtggagatctcagttggtgttgctccagagccacct
caaaacatatcatgtgtccaggaaggagaaaatggaactgtggcctgttcctggaactct
ggaaaagttacttatctgaaaaccaattacactttacagttaagtggaccaaacaatctg
acctgtcagaaacaatgtttttctgacaatcgtcagaattgcaatcgcctggatcttggg
atcaatctaagccctgatttagctgaatccaggttcatagtccgtgttactgccatcaac
gatcttggaaattcttcttcacttccgcatacgttcacgttcttggacatagtgatccct
cttcctccgtgggacatcagaatcaactttctaaatgcttctgggagcagaggtacactg
cagtgggaagatgaggggcaagtggtactcaatcaactcagatatcagcctcttaacagc
acgtcctggaacatggtcaatgctacaaatgccaaaggaaaatatgacctgcgagatctg
agaccgtttacagaatatgaatttcaaatctcctctaagctacatctctctggaggaagt
tggagtaattggagtgagtcactgagaacacgaacaccagaggaagagcctgttgggata
ttagacatctggtacatgaaacaagacatcgactatgacagacagcagatctctcttttc
tggaagagtctgaatccatcagaggcaagggggaagatcctccactatcaggtgacgtta
caagaggtgacaaagaaaacaacactgcagaatactacaagacacacctcctggaccagg
gtcatcccccgaactggggcttggacggcatcagtgtctgcagccaactcaaaaggcgct
tctgcacccactcacattaacatagtggacctatgtggcactgggttgctggctcctcac
caggtctctgcaaagtcggagaacatggacaacattctagtgacctggcagcctcctaag
aaagctgattctgctgttcgggagtacatagtggaatggagagctctccaaccagggagc
atcacgaagtttcccccacactggctgcggatccccccggacaacatgtctgctctgatt
tcagagaacataaagccctatatctgttatgaaatcagggtgcatgcactgtcagagagc
caaggagggtgcagctccatccggggtgactccaagcacaaagcaccagtgagtggccct
cacattactgccatcacagagaaaaaggaacgccttttcatttcctggacccacattcca
ttcccggagcaaaggggctgcatcctccattacagaatatactggaaagaacgagactcg
acagcacaacctgagctctgcgaaattcagtaccgacgctctcaaaactcacatccaata
agcagcctacagcccagggtgacatatgtcctatggatgacagctgtgacagctgctggt
gaaagtccccaaggaaatgaaagggaattttgtccacagggcaaagccaactggaaagca
ttcgtgatatcaagcatttgcatcgctatcatcacggtgggcacgttctcaattcgttac
ttccggcaaaaggcatttactctcctgtctactctcaaacctcaatggtatagcagaacc
attccagatccagcaaacagcacttgggtaaagaagtatcccattctggaggagaagatc
cagctacctacggataatctcctgatggcatggcccactcctgaagagcctgagcccctg
atcatccatgaagtcctctaccacatgatcccagttgtcagacaaccatattacttcaaa
agaggccaaggattccaaggctactctacctccaagcaagatgcaatgtatattgccaat
ccacaagctacaggaactctcacagctgagaccagacaactagtgaacctatacaaggtg
ctagaaagcagagaccctgactcaaaactggccaacctgaccagccccttgacagtcacc
ccagtgaactaccttcctagccatgaaggctatttaccctccaacatagaagatctgtca
ccacatgaggctgacccaactgattcttttgacctggagcatcaacatatttctctttcc
atttttgcatcaagttctctccgcccactcatcttcggtggtgagcggctgactctagat
cggttaaagatgggctatgactccctcatgagtaatgaggcttga

DBGET integrated database retrieval system