KEGG   Mus musculus (mouse): 16163
Entry
16163             CDS       T01002                                 

Gene name
Il13, Il-13
Definition
(RefSeq) interleukin 13
  KO
K05435  interleukin 13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  Jak-STAT signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04664  Fc epsilon RI signaling pathway
mmu05200  Pathways in cancer
mmu05310  Asthma
mmu05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16163 (Il13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16163 (Il13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16163 (Il13)
   04657 IL-17 signaling pathway
    16163 (Il13)
   04664 Fc epsilon RI signaling pathway
    16163 (Il13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16163 (Il13)
  09163 Immune disease
   05310 Asthma
    16163 (Il13)
   05321 Inflammatory bowel disease (IBD)
    16163 (Il13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16163 (Il13)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16163 (Il13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 16163
NCBI-ProteinID: NP_032381
MGI: 96541
Ensembl: ENSMUSG00000020383
Vega: OTTMUSG00000005641
UniProt: P20109
Position
11 B1.3; 11 31.98 cM
AA seq 131 aa
MALWVTAVLALACLGGLAAPGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVD
LAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLS
YTKQLFRHGPF
NT seq 396 nt   +upstreamnt  +downstreamnt
atggcgctctgggtgactgcagtcctggctcttgcttgccttggtggtctcgccgcccca
gggccggtgccaagatctgtgtctctccctctgacccttaaggagcttattgaggagctg
agcaacatcacacaagaccagactcccctgtgcaacggcagcatggtatggagtgtggac
ctggccgctggcgggttctgtgtagccctggattccctgaccaacatctccaattgcaat
gccatctacaggacccagaggatattgcatggcctctgtaaccgcaaggcccccactacg
gtctccagcctccccgataccaaaatcgaagtagcccactttataacaaaactgctcagc
tacacaaagcaactgtttcgccacggccccttctaa

DBGET integrated database retrieval system