KEGG   Mus musculus (mouse): 16171Help
Entry
16171             CDS       T01002                                 

Gene name
Il17a, Ctla-8, Ctla8, IL-17, IL-17A, Il17
Definition
(RefSeq) interleukin 17A
  KO
K05489  interleukin 17A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04657  IL-17 signaling pathway
mmu04659  Th17 cell differentiation
mmu05321  Inflammatory bowel disease (IBD)
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16171 (Il17a)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    16171 (Il17a)
   04657 IL-17 signaling pathway
    16171 (Il17a)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    16171 (Il17a)
   05321 Inflammatory bowel disease (IBD)
    16171 (Il17a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16171 (Il17a)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16171 (Il17a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL17
Motif
Other DBs
NCBI-GeneID: 16171
NCBI-ProteinID: NP_034682
MGI: 107364
Ensembl: ENSMUSG00000025929
Vega: OTTMUSG00000033825
UniProt: Q62386 Q544E6
Position
1; 1 A4
AA seq 158 aa AA seqDB search
MSPGRASSVSLMLLLLLSLAATVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAK
VSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQ
EILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgagtccagggagagcttcatctgtgtctctgatgctgttgctgctgctgagcctggcg
gctacagtgaaggcagcagcgatcatccctcaaagctcagcgtgtccaaacactgaggcc
aaggacttcctccagaatgtgaaggtcaacctcaaagtctttaactcccttggcgcaaaa
gtgagctccagaaggccctcagactacctcaaccgttccacgtcaccctggactctccac
cgcaatgaagaccctgatagatatccctctgtgatctgggaagctcagtgccgccaccag
cgctgtgtcaatgcggagggaaagctggaccaccacatgaattctgttctcatccagcaa
gagatcctggtcctgaagagggagcctgagagctgccccttcactttcagggtcgagaag
atgctggtgggtgtgggctgcacctgcgtggcctcgattgtccgccaggcagcctaa

DBGET integrated database retrieval system