KEGG   Mus musculus (mouse): 16173
Entry
16173             CDS       T01002                                 

Gene name
Il18, Ig, Igif, Il-, Il-18
Definition
(RefSeq) interleukin 18
  KO
K05482  interleukin 18
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04621  NOD-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu05132  Salmonella infection
mmu05134  Legionellosis
mmu05135  Yersinia infection
mmu05143  African trypanosomiasis
mmu05144  Malaria
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05321  Inflammatory bowel disease
mmu05323  Rheumatoid arthritis
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16173 (Il18)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16173 (Il18)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    16173 (Il18)
   04623 Cytosolic DNA-sensing pathway
    16173 (Il18)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    16173 (Il18)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16173 (Il18)
   05135 Yersinia infection
    16173 (Il18)
   05134 Legionellosis
    16173 (Il18)
   05152 Tuberculosis
    16173 (Il18)
  09174 Infectious disease: parasitic
   05144 Malaria
    16173 (Il18)
   05143 African trypanosomiasis
    16173 (Il18)
  09163 Immune disease
   05323 Rheumatoid arthritis
    16173 (Il18)
   05321 Inflammatory bowel disease
    16173 (Il18)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    16173 (Il18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16173 (Il18)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16173 (Il18)
SSDB
Motif
Pfam: IL1 DUF273 NCA2
Other DBs
NCBI-GeneID: 16173
NCBI-ProteinID: NP_032386
MGI: 107936
Ensembl: ENSMUSG00000039217
Vega: OTTMUSG00000063071
UniProt: P70380 Q2PMY2
Position
9 A5.3; 9 27.75 cM
AA seq 192 aa
MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKR
QPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEM
DPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDK
SVMFTLTNLHQS
NT seq 579 nt   +upstreamnt  +downstreamnt
atggctgccatgtcagaagactcttgcgtcaacttcaaggaaatgatgtttattgacaac
acgctttactttatacctgaagaaaatggagacctggaatcagacaactttggccgactt
cactgtacaaccgcagtaatacggaatataaatgaccaagttctcttcgttgacaaaaga
cagcctgtgttcgaggatatgactgatattgatcaaagtgccagtgaaccccagaccaga
ctgataatatacatgtacaaagacagtgaagtaagaggactggctgtgaccctctctgtg
aaggatagtaaaatgtctaccctctcctgtaagaacaagatcatttcctttgaggaaatg
gatccacctgaaaatattgatgatatacaaagtgatctcatattctttcagaaacgtgtt
ccaggacacaacaagatggagtttgaatcttcactgtatgaaggacactttcttgcttgc
caaaaggaagatgatgctttcaaactcattctgaaaaaaaaggatgaaaatggggataaa
tctgtaatgttcactctcactaacttacatcaaagttag

DBGET integrated database retrieval system