KEGG   Mus musculus (mouse): 16173Help
Entry
16173             CDS       T01002                                 

Gene name
Il18, Igif, Il-18
Definition
(RefSeq) interleukin 18
  KO
K05482  interleukin 18
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04621  NOD-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu05132  Salmonella infection
mmu05134  Legionellosis
mmu05135  Yersinia infection
mmu05143  African trypanosomiasis
mmu05144  Malaria
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05321  Inflammatory bowel disease (IBD)
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16173 (Il18)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16173 (Il18)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    16173 (Il18)
   04623 Cytosolic DNA-sensing pathway
    16173 (Il18)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    16173 (Il18)
   05321 Inflammatory bowel disease (IBD)
    16173 (Il18)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16173 (Il18)
   05135 Yersinia infection
    16173 (Il18)
   05134 Legionellosis
    16173 (Il18)
   05152 Tuberculosis
    16173 (Il18)
  09172 Infectious disease: viral
   05164 Influenza A
    16173 (Il18)
  09174 Infectious disease: parasitic
   05144 Malaria
    16173 (Il18)
   05143 African trypanosomiasis
    16173 (Il18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16173 (Il18)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16173 (Il18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1 DUF273 NCA2
Motif
Other DBs
NCBI-GeneID: 16173
NCBI-ProteinID: NP_032386
MGI: 107936
Ensembl: ENSMUSG00000039217
Vega: OTTMUSG00000063071
UniProt: P70380 Q2PMY2
Position
9 A5.3; 9 27.75 cM
AA seq 192 aa AA seqDB search
MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKR
QPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEM
DPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDK
SVMFTLTNLHQS
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatgtcagaagactcttgcgtcaacttcaaggaaatgatgtttattgacaac
acgctttactttatacctgaagaaaatggagacctggaatcagacaactttggccgactt
cactgtacaaccgcagtaatacggaatataaatgaccaagttctcttcgttgacaaaaga
cagcctgtgttcgaggatatgactgatattgatcaaagtgccagtgaaccccagaccaga
ctgataatatacatgtacaaagacagtgaagtaagaggactggctgtgaccctctctgtg
aaggatagtaaaatgtctaccctctcctgtaagaacaagatcatttcctttgaggaaatg
gatccacctgaaaatattgatgatatacaaagtgatctcatattctttcagaaacgtgtt
ccaggacacaacaagatggagtttgaatcttcactgtatgaaggacactttcttgcttgc
caaaaggaagatgatgctttcaaactcattctgaaaaaaaaggatgaaaatggggataaa
tctgtaatgttcactctcactaacttacatcaaagttag

DBGET integrated database retrieval system