KEGG   Mus musculus (mouse): 16175
Entry
16175             CDS       T01002                                 

Gene name
Il1a, Il, Il-1a
Definition
(RefSeq) interleukin 1 alpha
  KO
K04383  interleukin 1 alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04217  Necroptosis
mmu04218  Cellular senescence
mmu04380  Osteoclast differentiation
mmu04640  Hematopoietic cell lineage
mmu04932  Non-alcoholic fatty liver disease
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04940  Type I diabetes mellitus
mmu05010  Alzheimer disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05133  Pertussis
mmu05140  Leishmaniasis
mmu05152  Tuberculosis
mmu05162  Measles
mmu05164  Influenza A
mmu05321  Inflammatory bowel disease
mmu05323  Rheumatoid arthritis
mmu05332  Graft-versus-host disease
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16175 (Il1a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16175 (Il1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    16175 (Il1a)
   04218 Cellular senescence
    16175 (Il1a)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16175 (Il1a)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    16175 (Il1a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    16175 (Il1a)
   05162 Measles
    16175 (Il1a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    16175 (Il1a)
   05152 Tuberculosis
    16175 (Il1a)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    16175 (Il1a)
  09163 Immune disease
   05323 Rheumatoid arthritis
    16175 (Il1a)
   05321 Inflammatory bowel disease
    16175 (Il1a)
   05332 Graft-versus-host disease
    16175 (Il1a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16175 (Il1a)
   05020 Prion disease
    16175 (Il1a)
   05022 Pathways of neurodegeneration - multiple diseases
    16175 (Il1a)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16175 (Il1a)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    16175 (Il1a)
   04932 Non-alcoholic fatty liver disease
    16175 (Il1a)
   04933 AGE-RAGE signaling pathway in diabetic complications
    16175 (Il1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16175 (Il1a)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16175 (Il1a)
SSDB
Motif
Pfam: IL1 IL1_propep
Other DBs
NCBI-GeneID: 16175
NCBI-ProteinID: NP_034684
MGI: 96542
Ensembl: ENSMUSG00000027399
Vega: OTTMUSG00000015415
UniProt: P01582 Q3U0Y6
Position
2 F1; 2 62.9 cM
AA seq 270 aa
MAKVPDLFEDLKNCYSENEDYSSAIDHLSLNQKSFYDASYGSLHETCTDQFVSLRTSETS
KMSNFTFKESRVTVSATSSNGKILKKRRLSFSETFTEDDLQSITHDLEETIQPRSAPYTY
QSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDD
SKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSA
AYPELFIATKEQSRVHLARGLPSMTDFQIS
NT seq 813 nt   +upstreamnt  +downstreamnt
atggccaaagttcctgacttgtttgaagacctaaagaactgttacagtgaaaacgaagac
tacagttctgccattgaccatctctctctgaatcagaaatccttctatgatgcaagctat
ggctcacttcatgagacttgcacagatcagtttgtatctctgagaacctctgaaacgtca
aagatgtccaacttcaccttcaaggagagccgggtgacagtatcagcaacgtcaagcaac
gggaagattctgaagaagagacggctgagtttcagtgagaccttcactgaagatgacctg
cagtccataacccatgatctggaagagaccatccaacccagatcagcaccttacacctac
cagagtgatttgagatacaaactgatgaagctcgtcaggcagaagtttgtcatgaatgat
tccctcaaccaaactatatatcaggatgtggacaaacactatctcagcaccacttggtta
aatgacctgcaacaggaagtaaaatttgacatgtatgcctactcgtcgggaggagacgac
tctaaatatcctgttactctaaaaatctcagattcacaactgttcgtgagcgctcaagga
gaagaccagcccgtgttgctgaaggagttgccagaaacaccaaaactcatcacaggtagt
gagaccgacctcattttcttctggaaaagtatcaactctaagaactacttcacatcagct
gcttatccagagctgtttattgccaccaaagaacaaagtcgggtgcacctggcacgggga
ctgccctctatgacagacttccagatatcataa

DBGET integrated database retrieval system