KEGG   Mus musculus (mouse): 16178Help
Entry
16178             CDS       T01002                                 

Gene name
Il1r2, CD121b, Il1r-2
Definition
(RefSeq) interleukin 1 receptor, type II
  KO
K04387  interleukin 1 receptor type II
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04640  Hematopoietic cell lineage
mmu05146  Amoebiasis
mmu05166  Human T-cell leukemia virus 1 infection
mmu05202  Transcriptional misregulation in cancer
mmu05215  Prostate cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16178 (Il1r2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16178 (Il1r2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    16178 (Il1r2)
  09162 Cancer: specific types
   05215 Prostate cancer
    16178 (Il1r2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16178 (Il1r2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16178 (Il1r2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16178 (Il1r2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16178 (Il1r2)
   04090 CD molecules [BR:mmu04090]
    16178 (Il1r2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL1 receptor family
   16178 (Il1r2)
CD molecules [BR:mmu04090]
 Proteins
  16178 (Il1r2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_3 I-set Ig_6 V-set Ig_2 Izumo-Ig Ig_5
Motif
Other DBs
NCBI-GeneID: 16178
NCBI-ProteinID: NP_034685
MGI: 96546
Ensembl: ENSMUSG00000026073
Vega: OTTMUSG00000050443
UniProt: P27931 Q4FK69
Position
1 B; 1 18.65 cM
AA seq 410 aa AA seqDB search
MFILLVLVTGVSAFTTPTVVHTGKVSESPITSEKPTVHGDNCQFRGREFKSELRLEGEPV
VLRCPLAPHSDISSSSHSFLTWSKLDSSQLIPRDEPRMWVKGNILWILPAVQQDSGTYIC
TFRNASHCEQMSVELKVFKNTEASLPHVSYLQISALSTTGLLVCPDLKEFISSNADGKIQ
WYKGAILLDKGNKEFLSAGDPTRLLISNTSMDDAGYYRCVMTFTYNGQEYNITRNIELRV
KGTTTEPIPVIISPLETIPASLGSRLIVPCKVFLGTGTSSNTIVWWLANSTFISAAYPRG
RVTEGLHHQYSENDENYVEVSLIFDPVTREDLHTDFKCVASNPRSSQSLHTTVKEVSSTF
SWSIALAPLSLIILVVGAIWMRRRCKRRAGKTYGLTKLRTDNQDFPSSPN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgttcatcttgcttgtgttagtaactggagtttctgctttcaccactccaacagtggtg
cacacaggaaaggtttctgaatcccccattacatcggagaagcccacagtccatggagac
aactgtcagtttcgtggcagagagttcaaatctgaattgaggctggaaggtgaacctgtg
gttctgaggtgccccttggcacctcactccgacatctccagcagttcccatagttttctg
acctggagtaaattggactcttctcagctgatcccaagagatgagccaaggatgtgggtg
aagggtaacatactctggattctgccagcagtgcagcaagactctggtacctacatttgc
acattcagaaacgcatcccactgtgagcaaatgtctgtggaactcaaggtctttaagaat
actgaagcatctctgcctcatgtctcctacttgcaaatctcagctctctccaccaccggg
ttactagtgtgccctgacctgaaagaattcatctccagcaacgctgatggaaagatacag
tggtataagggcgccatactcttggataaaggcaataaggaatttctgagtgcaggagac
cccacacgcctattgatatccaacacgtccatggacgatgcaggctattacagatgtgtt
atgacatttacctacaatggccaggaatacaacatcactaggaatattgaactccgggtc
aaaggaacaaccacggaacccatccctgtgatcatttctcccctggagacaataccagca
tcattggggtcaagactgatagtcccgtgcaaagtgtttctgggaactggtacatcttcc
aacaccattgtgtggtggttggctaacagcacgtttatctcggctgcttacccaagaggc
cgtgtgaccgaggggctacaccaccagtactcagagaatgatgaaaactatgtggaagtg
tcgctgatttttgatccagtcacaagggaggatctgcatacagattttaaatgtgttgcc
tcgaatccacggagttctcagtcactccataccacagtcaaagaagtctcttccacgttc
tcctggagcattgcgctggcacctctgtctctgatcatcttggttgtgggggcaatatgg
atgcgcagacggtgtaaacgcagggctggaaagacatatggactgaccaagctacggact
gacaaccaggacttcccttccagcccaaactaa

DBGET integrated database retrieval system