KEGG   Mus musculus (house mouse): 16179
Entry
16179             CDS       T01002                                 
Symbol
Irak1, AA408924, IRAK, IRAK-1, IRAK1-S, IRAK1b, Il1rak, Plpk, mPLK
Name
(RefSeq) interleukin-1 receptor-associated kinase 1
  KO
K04730  interleukin-1 receptor-associated kinase 1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04936  Alcoholic liver disease
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05162  Measles
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16179 (Irak1)
   04064 NF-kappa B signaling pathway
    16179 (Irak1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    16179 (Irak1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    16179 (Irak1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    16179 (Irak1)
   05161 Hepatitis B
    16179 (Irak1)
   05171 Coronavirus disease - COVID-19
    16179 (Irak1)
   05162 Measles
    16179 (Irak1)
   05168 Herpes simplex virus 1 infection
    16179 (Irak1)
   05169 Epstein-Barr virus infection
    16179 (Irak1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16179 (Irak1)
   05135 Yersinia infection
    16179 (Irak1)
   05133 Pertussis
    16179 (Irak1)
   05152 Tuberculosis
    16179 (Irak1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    16179 (Irak1)
   05140 Leishmaniasis
    16179 (Irak1)
   05142 Chagas disease
    16179 (Irak1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    16179 (Irak1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    16179 (Irak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16179 (Irak1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     16179 (Irak1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   16179 (Irak1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Death RAMP APH Seadorna_VP7
Other DBs
NCBI-GeneID: 16179
NCBI-ProteinID: NP_001171445
MGI: 107420
Ensembl: ENSMUSG00000031392
UniProt: Q62406 Q540G0
Position
X:complement(73057520..73067527)
AA seq 710 aa
MAGGPGPGEPVVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPVVPPSTAAPRPSS
ISAGSEAGDWSPRKLQSSASTFLSPAFPGSQTHSESELLQVPLPVSLGPPLPSSAPSSTK
SSPESPVSGLQRAHPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKR
LKEEADLEWTMVKQSFLTEVEQLSRFRHPNIVDFAGYCAESGLYCLVYGFLPNGSLEDQL
HLQTQACSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLMPKLGDFG
LARFSRFAGAKASQSSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVILETLAG
QRAVRTQGAKTKYLKDLIEDEAEEAGVTLKSTQPTLWVGVATDAWAAPIAAQIYKKHLDS
RPGPCPPQLGLALAQLACCCMHRRAKKRPPMTQVYKRLEGLQAGPPWELEVAGHGSPSPQ
ENSYMSTTGSAQSGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLSATLHSWH
LTPGSHPSPASFREASCTQGGTTRESSVRSSPGFQPTTMEGSPTGSSSLLSSEPPQIIIN
PARQKMVQKLALYEEGVLDSLQLLSSGFFPGLDLEPEKSQGPEESDEFQS
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggccggggggccgggccccggggagcctgtggttccaggcgcccagcacttcttgtac
gaggtgccaccctgggttatgtgccgcttctacaaagtgatggacgccctggagcccgcc
gactggtgccagttcgcggccttgatcgtgcgcgaccagacagagctgcggctgtgcgag
cgctccgagcagcgcacagccagtgttctgtggccctggatcaaccgcaacgcgcgcgta
gctgacctcgttcacatcctcacgcacctgcagctgctgcgtgcgagggacatcatcaca
gcctggcaccctcctgcccccgttgtgcccccaagcaccgctgccccaaggcccagcagc
atctctgcaggctctgaggccggggactggagcccccggaaattgcagtcctctgcctcc
accttcctctccccagcttttccaggctcccagacccattctgagtcagagctcctccag
gttccactccctgtttccctcgggccaccactaccatcttcagccccttcctccaccaag
tcaagcccagagagcccagtgtctggcctccaaagagcccatccctccccgttttgctgg
cccttctgtgagatttcccaaggcacctgcaacttctctgaagaactcaggattggagag
ggtggttttggatgtgtgtaccgagcagtcatgagaaatactacatatgctgtgaagaga
ctgaaggaggaagctgacctagagtggactatggtgaaacagagcttcttaacagaggtg
gaacagctatcaaggtttcgtcacccaaatatcgtagactttgctggctactgtgcagag
agtggcttatactgccttgtttatggcttcttgcccaatggctccttggaggatcagctc
caccttcagacccaggcctgctccccactttcctggcctcaacgactggacattcttctg
ggcacagcccgggctattcagtttttacatcaggatagccccagccttatccatggagac
atcaagagttctaacgtgcttctggatgagagactgatgcccaagctgggagactttggc
ctggctcgtttcagccgctttgcgggggccaaagcaagccagagcagtactgtggcccgg
acttccacagttcgaggtaccctcgcctacttgcctgaggagtacatcaagacaggccga
ctggctgtggacaccgataccttcagctttggggtggtaatactggagacccttgctggt
cagagggctgtgaggacacaaggtgcaaagaccaagtatttgaaagacctgattgaagat
gaggctgaagaggctggagtgaccctgaaaagcacccagcctactctgtgggtgggtgta
gccacggatgcttgggctgctccaattgctgcccagatctataagaagcacctggactcc
agacctgggccctgcccaccccagttgggcctggccctggctcaactagcttgctgctgc
atgcaccgtcgggccaagaagaggccccccatgacccaggtatacaagagactagaaggg
cttcaggcagggcctccctgggagctagaggttgccggccatggctccccttccccacag
gagaactcctacatgtctaccactggcagtgcccagagtggggatgaaccatggcagcct
ctagtagtgaccacaagagccccagcccaggctgcccagcaactccagagaagtcccaac
cagccagtggaaagtgatgagagtgttcccggcctctctgctaccctgcattcctggcac
ttgactccaggttcccacccaagcccagcgtccttcagagaggctagctgtacccaggga
ggcactaccagagaatcaagtgtgaggagtagcccaggcttccagcctacaaccatggaa
ggctcacccacgggcagctcatccctgctgtcatcagaaccaccacagatcatcatcaac
ccagcccgacagaagatggtacaaaagctggctctttatgaagaaggggtcttggatagc
ctgcaactgctgtcatcaggctttttcccaggcttggatttagaacctgaaaagagccag
ggacctgaagaaagtgatgaattccagagctga

DBGET integrated database retrieval system