KEGG   Mus musculus (mouse): 16179Help
Entry
16179             CDS       T01002                                 

Gene name
Irak1, AA408924, IRAK, IRAK-1, IRAK1-S, IRAK1b, Il1rak, Plpk, mPLK
Definition
(RefSeq) interleukin-1 receptor-associated kinase 1
  KO
K04730  interleukin-1 receptor-associated kinase 1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu05133  Pertussis
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05162  Measles
mmu05169  Epstein-Barr virus infection
Module
mmu_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16179 (Irak1)
   04064 NF-kappa B signaling pathway
    16179 (Irak1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    16179 (Irak1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    16179 (Irak1)
 09160 Human Diseases
  09167 Infectious diseases
   05133 Pertussis
    16179 (Irak1)
   05152 Tuberculosis
    16179 (Irak1)
   05162 Measles
    16179 (Irak1)
   05169 Epstein-Barr virus infection
    16179 (Irak1)
   05145 Toxoplasmosis
    16179 (Irak1)
   05140 Leishmaniasis
    16179 (Irak1)
   05142 Chagas disease (American trypanosomiasis)
    16179 (Irak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16179 (Irak1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     16179 (Irak1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   16179 (Irak1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Death RAMP APH Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 16179
NCBI-ProteinID: NP_001171445
MGI: 107420
Ensembl: ENSMUSG00000031392
Vega: OTTMUSG00000017687
UniProt: Q62406 Q540G0
Position
X A7.3; X 37.61 cM
AA seq 710 aa AA seqDB search
MAGGPGPGEPVVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPVVPPSTAAPRPSS
ISAGSEAGDWSPRKLQSSASTFLSPAFPGSQTHSESELLQVPLPVSLGPPLPSSAPSSTK
SSPESPVSGLQRAHPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKR
LKEEADLEWTMVKQSFLTEVEQLSRFRHPNIVDFAGYCAESGLYCLVYGFLPNGSLEDQL
HLQTQACSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLMPKLGDFG
LARFSRFAGAKASQSSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVILETLAG
QRAVRTQGAKTKYLKDLIEDEAEEAGVTLKSTQPTLWVGVATDAWAAPIAAQIYKKHLDS
RPGPCPPQLGLALAQLACCCMHRRAKKRPPMTQVYKRLEGLQAGPPWELEVAGHGSPSPQ
ENSYMSTTGSAQSGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLSATLHSWH
LTPGSHPSPASFREASCTQGGTTRESSVRSSPGFQPTTMEGSPTGSSSLLSSEPPQIIIN
PARQKMVQKLALYEEGVLDSLQLLSSGFFPGLDLEPEKSQGPEESDEFQS
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggccggggggccgggccccggggagcctgtggttccaggcgcccagcacttcttgtac
gaggtgccaccctgggttatgtgccgcttctacaaagtgatggacgccctggagcccgcc
gactggtgccagttcgcggccttgatcgtgcgcgaccagacagagctgcggctgtgcgag
cgctccgagcagcgcacagccagtgttctgtggccctggatcaaccgcaacgcgcgcgta
gctgacctcgttcacatcctcacgcacctgcagctgctgcgtgcgagggacatcatcaca
gcctggcaccctcctgcccccgttgtgcccccaagcaccgctgccccaaggcccagcagc
atctctgcaggctctgaggccggggactggagcccccggaaattgcagtcctctgcctcc
accttcctctccccagcttttccaggctcccagacccattctgagtcagagctcctccag
gttccactccctgtttccctcgggccaccactaccatcttcagccccttcctccaccaag
tcaagcccagagagcccagtgtctggcctccaaagagcccatccctccccgttttgctgg
cccttctgtgagatttcccaaggcacctgcaacttctctgaagaactcaggattggagag
ggtggttttggatgtgtgtaccgagcagtcatgagaaatactacatatgctgtgaagaga
ctgaaggaggaagctgacctagagtggactatggtgaaacagagcttcttaacagaggtg
gaacagctatcaaggtttcgtcacccaaatatcgtagactttgctggctactgtgcagag
agtggcttatactgccttgtttatggcttcttgcccaatggctccttggaggatcagctc
caccttcagacccaggcctgctccccactttcctggcctcaacgactggacattcttctg
ggcacagcccgggctattcagtttttacatcaggatagccccagccttatccatggagac
atcaagagttctaacgtgcttctggatgagagactgatgcccaagctgggagactttggc
ctggctcgtttcagccgctttgcgggggccaaagcaagccagagcagtactgtggcccgg
acttccacagttcgaggtaccctcgcctacttgcctgaggagtacatcaagacaggccga
ctggctgtggacaccgataccttcagctttggggtggtaatactggagacccttgctggt
cagagggctgtgaggacacaaggtgcaaagaccaagtatttgaaagacctgattgaagat
gaggctgaagaggctggagtgaccctgaaaagcacccagcctactctgtgggtgggtgta
gccacggatgcttgggctgctccaattgctgcccagatctataagaagcacctggactcc
agacctgggccctgcccaccccagttgggcctggccctggctcaactagcttgctgctgc
atgcaccgtcgggccaagaagaggccccccatgacccaggtatacaagagactagaaggg
cttcaggcagggcctccctgggagctagaggttgccggccatggctccccttccccacag
gagaactcctacatgtctaccactggcagtgcccagagtggggatgaaccatggcagcct
ctagtagtgaccacaagagccccagcccaggctgcccagcaactccagagaagtcccaac
cagccagtggaaagtgatgagagtgttcccggcctctctgctaccctgcattcctggcac
ttgactccaggttcccacccaagcccagcgtccttcagagaggctagctgtacccaggga
ggcactaccagagaatcaagtgtgaggagtagcccaggcttccagcctacaaccatggaa
ggctcacccacgggcagctcatccctgctgtcatcagaaccaccacagatcatcatcaac
ccagcccgacagaagatggtacaaaagctggctctttatgaagaaggggtcttggatagc
ctgcaactgctgtcatcaggctttttcccaggcttggatttagaacctgaaaagagccag
ggacctgaagaaagtgatgaattccagagctga

DBGET integrated database retrieval system