KEGG   Mus musculus (mouse): 16184
Entry
16184             CDS       T01002                                 

Gene name
Il2ra, CD25, I, Il2r, Ly-4, Ly-43
Definition
(RefSeq) interleukin 2 receptor, alpha chain
  KO
K05068  interleukin 2 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16184 (Il2ra)
   04151 PI3K-Akt signaling pathway
    16184 (Il2ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16184 (Il2ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16184 (Il2ra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16184 (Il2ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16184 (Il2ra)
   04658 Th1 and Th2 cell differentiation
    16184 (Il2ra)
   04659 Th17 cell differentiation
    16184 (Il2ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16184 (Il2ra)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16184 (Il2ra)
   05162 Measles
    16184 (Il2ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16184 (Il2ra)
   04090 CD molecules [BR:mmu04090]
    16184 (Il2ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16184 (Il2ra)
CD molecules [BR:mmu04090]
 Proteins
  16184 (Il2ra)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 16184
NCBI-ProteinID: NP_032393
MGI: 96549
Ensembl: ENSMUSG00000026770
Vega: OTTMUSG00000011179
UniProt: P01590 Q544I2
Position
2 A1; 2 8.91 cM
AA seq 268 aa
MEPRLLMLGFLSLTIVPSCRAELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKE
LVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGH
CREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTC
VDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYKVAVA
SCLFLLISILLLSGLTWQHRWRKSRRTI
NT seq 807 nt   +upstreamnt  +downstreamnt
atggagccacgcttgctgatgttggggtttctctcattaaccatagtacccagttgtcgg
gcagaactgtgtctgtatgacccacccgaggtccccaatgccacattcaaagccctctcc
tacaagaacggcaccatcctaaactgtgaatgcaagagaggtttccgaagactaaaggaa
ttggtctatatgcgttgcttaggaaactcctggagcagcaactgccagtgcaccagcaac
tcccatgacaaatcgagaaagcaagttacagctcaacttgaacaccagaaagagcaacaa
accacaacagacatgcagaagccaacacagtctatgcaccaagagaaccttacaggtcac
tgcagggagccacctccttggaaacatgaagattccaagagaatctatcatttcgtggaa
ggacagagtgttcactacgagtgtattccgggatacaaggctctacagagaggtcctgct
attagcatctgcaagatgaagtgtgggaaaacggggtggactcagccccagctcacatgt
gtagatgaaagagaacaccaccgatttctggctagtgaggaatctcaaggaagcagaaat
tcttctcccgagagtgagacttcctgccccataaccaccacagacttcccacaacccaca
gaaacaactgcaatgacggagacatttgtgctcacaatggagtataaggtagcagtggcc
agctgcctcttcctgctcatcagcatcctcctcctgagcgggctcacctggcaacacaga
tggaggaagagcagaagaaccatctag

KEGG   Mus musculus (mouse): 16185
Entry
16185             CDS       T01002                                 

Gene name
Il2rb, CD122, IL-15R, IL-15Rbeta, IL15R, IL15Rbeta, Il-2/15Rbeta, Il-2R, Il-2Rbeta, p70
Definition
(RefSeq) interleukin 2 receptor, beta chain
  KO
K05069  interleukin 2 receptor beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16185 (Il2rb)
   04151 PI3K-Akt signaling pathway
    16185 (Il2rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16185 (Il2rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16185 (Il2rb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16185 (Il2rb)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16185 (Il2rb)
   04659 Th17 cell differentiation
    16185 (Il2rb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16185 (Il2rb)
   05202 Transcriptional misregulation in cancer
    16185 (Il2rb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16185 (Il2rb)
   05162 Measles
    16185 (Il2rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16185 (Il2rb)
   04090 CD molecules [BR:mmu04090]
    16185 (Il2rb)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16185 (Il2rb)
CD molecules [BR:mmu04090]
 Proteins
  16185 (Il2rb)
SSDB
Motif
Pfam: IL2RB_N1 fn3
Other DBs
NCBI-GeneID: 16185
NCBI-ProteinID: NP_032394
MGI: 96550
Ensembl: ENSMUSG00000068227
UniProt: P16297
Structure
PDB: 
6DG5

Position
15 E1; 15 37.52 cM
AA seq 539 aa
MATIALPWSLSLYVFLLLLATPWASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCH
VHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRV
KTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWE
DASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
ILPMSWLRYLLLVLGCFSGFFSCVYILVKCRYLGPWLKTVLKCHIPDPSEFFSQLSSQHG
GDLQKWLSSPVPLSFFSPSGPAPEISPLEVLDGDSKAVQLLLLQKDSAPLPSPSGHSQAS
CFTNQGYFFFHLPNALEIESCQVYFTYDPCVEEEVEEDGSRLPEGSPHPPLLPLAGEQDD
YCAFPPRDDLLLFSPSLSTPNTAYGGSRAPEERSPLSLHEGLPSLASRDLMGLQRPLERM
PEGDGEGLSANSSGEQASVPEGNLHGQDQDRGQGPILTLNTDAYLSLQELQAQDSVHLI
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggctaccatagctcttccctggagcctgtccctctacgtcttcctcctgctcctggct
acaccttgggcatctgcagcagtgaaaaactgttcccatcttgaatgcttctacaactca
agagccaatgtctcttgcatgtggagccatgaagaggctctgaatgtcacaacctgccac
gtccatgccaagtcgaacctgcgacactggaacaaaacctgtgagctaactcttgtgagg
caggcatcctgggcctgcaacctgatcctcgggtcgttcccagagtcccagtcactgacc
tccgtggacctccttgacataaatgtggtgtgctgggaagagaagggttggcgtagggta
aagacctgcgacttccatccctttgacaaccttcgcctggtggcccctcattccctccaa
gttctgcacattgatacccagagatgtaacataagctggaaggtctcccaggtctctcac
tacattgaaccatacttggaatttgaggcccgtagacgtcttctgggccacagctgggag
gatgcatccgtattaagcctcaagcagagacagcagtggctcttcttggagatgctgatc
cctagtacctcatatgaggtccaggtgagggtcaaagctcaacgaaacaataccgggacc
tggagtccctggagccagcccctgacctttcggacaaggccagcagatcccatgaaggag
atcctccccatgtcatggctcagataccttctgctggtccttggttgtttttctggcttc
ttctcctgcgtctacattttggtcaagtgccggtaccttgggccatggctgaagacagtt
ctcaagtgccacatcccagatccttctgagttcttctcccagctgagctcccagcatggg
ggagaccttcagaaatggctctcctcgcctgtccccttgtccttcttcagccccagtggc
cctgcccctgagatctctccgctggaagtgctcgacggagattccaaggccgtgcagctg
ctcctgttacagaaggactctgcccctttaccctcgcccagcggccactcacaggccagc
tgcttcaccaaccagggctacttcttcttccatctgcccaatgccttggagatcgaatcc
tgccaggtgtacttcacctatgacccctgtgtggaagaggaggtggaggaggatgggtca
aggctgcccgagggatctccccacccacctctgctgcctctggctggagaacaggatgac
tactgtgccttcccgcccagggatgacctgctgctcttctccccgagcctcagcaccccc
aacactgcctatgggggcagcagagcccctgaagaaagatctccactctccctgcatgag
ggacttccctccctagcatcccgtgacctgatgggcttacagcgccctctggagcggatg
ccggaaggtgatggagaggggctgtctgccaatagctctggggagcaggccagtgtccca
gaaggcaaccttcatgggcaagatcaggacagaggccagggccccatcctgaccctgaac
accgatgcctatctgtctcttcaagaactacaggcccaagattcagtccacctaatatag

KEGG   Mus musculus (mouse): 16186
Entry
16186             CDS       T01002                                 

Gene name
Il2rg, CD132, [g]c, gamm, gamma(, gamma(c), gc, p64
Definition
(RefSeq) interleukin 2 receptor, gamma chain
  KO
K05070  interleukin 2 receptor gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16186 (Il2rg)
   04151 PI3K-Akt signaling pathway
    16186 (Il2rg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16186 (Il2rg)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16186 (Il2rg)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16186 (Il2rg)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16186 (Il2rg)
   04659 Th17 cell differentiation
    16186 (Il2rg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16186 (Il2rg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16186 (Il2rg)
   05162 Measles
    16186 (Il2rg)
  09163 Immune disease
   05321 Inflammatory bowel disease
    16186 (Il2rg)
   05340 Primary immunodeficiency
    16186 (Il2rg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16186 (Il2rg)
   04090 CD molecules [BR:mmu04090]
    16186 (Il2rg)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16186 (Il2rg)
CD molecules [BR:mmu04090]
 Proteins
  16186 (Il2rg)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind IL4Ra_N Interfer-bind LIFR_N IL2RB_N1
Other DBs
NCBI-GeneID: 16186
NCBI-ProteinID: NP_038591
MGI: 96551
Ensembl: ENSMUSG00000031304
Vega: OTTMUSG00000018211
UniProt: P34902 Q3UPA9
Structure
PDB: 
6DG5

Position
X D; X 43.9 cM
AA seq 369 aa
MLKLLLSPRSFLVLQLLLLRAGWSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEV
QCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKE
DIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIK
ERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSK
WSQPVHWGSHTVEENPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPPIPPIKNLEDLV
TEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPP
PCYSLKPEA
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaaactattattgtcacctagatccttcttagtccttcagctgctcctgctgagg
gcagggtggagctccaaggtcctcatgtccagtgcgaatgaagacatcaaagctgatttg
atcctgacttctacagcccctgaacacctcagtgctcctactctgccccttccagaggtt
cagtgctttgtgttcaacatagagtacatgaattgcacttggaatagcagttctgagcct
caggcaaccaacctcacgctgcactataggtacaaggtatctgataataatacattccag
gagtgcagtcactatttgttctccaaagagattacttctggctgtcagatacaaaaagaa
gatatccagctctaccagacatttgttgtccagctccaggacccccagaaaccccagagg
cgagctgtacagaagctaaacctacagaatcttgtgatcccacgggctccagaaaatcta
acactcagcaatctgagtgaatcccagctagagctgagatggaaaagcagacatattaaa
gaacgctgtttacaatacttggtgcagtaccggagcaacagagatcgaagctggacggaa
ctaatagtgaatcatgaacctagattctccctgcctagtgtggatgagctgaaacggtac
acatttcgggttcggagccgctataacccaatctgtggaagttctcaacagtggagtaaa
tggagccagcctgtccactgggggagtcatactgtagaggagaatccttccttgtttgca
ctggaagctgtgcttatccctgttggcaccatggggttgattattaccctgatctttgtg
tactgttggttggaacgaatgcctccaattccccccatcaagaatctagaggatctggtt
actgaataccaagggaacttttcggcctggagtggtgtgtctaaagggctgactgagagt
ctgcagccagactacagtgaacggttctgccacgtcagcgagattccccccaaaggaggg
gccctaggagaggggcctggaggttctccttgcagcctgcatagcccttactggcctccc
ccatgttattctctgaagccggaagcctga

DBGET integrated database retrieval system