KEGG   Mus musculus (mouse): 16186Help
Entry
16186             CDS       T01002                                 

Gene name
Il2rg, CD132, [g]c, gamma(c), gc, p64
Definition
(RefSeq) interleukin 2 receptor, gamma chain
  KO
K05070  interleukin 2 receptor gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease (IBD)
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16186 (Il2rg)
   04151 PI3K-Akt signaling pathway
    16186 (Il2rg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16186 (Il2rg)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16186 (Il2rg)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16186 (Il2rg)
   04659 Th17 cell differentiation
    16186 (Il2rg)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    16186 (Il2rg)
  09163 Immune diseases
   05321 Inflammatory bowel disease (IBD)
    16186 (Il2rg)
   05340 Primary immunodeficiency
    16186 (Il2rg)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    16186 (Il2rg)
   05162 Measles
    16186 (Il2rg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16186 (Il2rg)
   04090 CD molecules [BR:mmu04090]
    16186 (Il2rg)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16186 (Il2rg)
CD molecules [BR:mmu04090]
 Proteins
  16186 (Il2rg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind IL4Ra_N Interfer-bind IL2RB_N1 Tissue_fac
Motif
Other DBs
NCBI-GeneID: 16186
NCBI-ProteinID: NP_038591
MGI: 96551
Ensembl: ENSMUSG00000031304
Vega: OTTMUSG00000018211
UniProt: P34902 Q3UPA9
Structure
PDB: 

Position
X D; X 43.9 cM
AA seq 369 aa AA seqDB search
MLKLLLSPRSFLVLQLLLLRAGWSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEV
QCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKE
DIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIK
ERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSK
WSQPVHWGSHTVEENPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPPIPPIKNLEDLV
TEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPP
PCYSLKPEA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactattattgtcacctagatccttcttagtccttcagctgctcctgctgagg
gcagggtggagctccaaggtcctcatgtccagtgcgaatgaagacatcaaagctgatttg
atcctgacttctacagcccctgaacacctcagtgctcctactctgccccttccagaggtt
cagtgctttgtgttcaacatagagtacatgaattgcacttggaatagcagttctgagcct
caggcaaccaacctcacgctgcactataggtacaaggtatctgataataatacattccag
gagtgcagtcactatttgttctccaaagagattacttctggctgtcagatacaaaaagaa
gatatccagctctaccagacatttgttgtccagctccaggacccccagaaaccccagagg
cgagctgtacagaagctaaacctacagaatcttgtgatcccacgggctccagaaaatcta
acactcagcaatctgagtgaatcccagctagagctgagatggaaaagcagacatattaaa
gaacgctgtttacaatacttggtgcagtaccggagcaacagagatcgaagctggacggaa
ctaatagtgaatcatgaacctagattctccctgcctagtgtggatgagctgaaacggtac
acatttcgggttcggagccgctataacccaatctgtggaagttctcaacagtggagtaaa
tggagccagcctgtccactgggggagtcatactgtagaggagaatccttccttgtttgca
ctggaagctgtgcttatccctgttggcaccatggggttgattattaccctgatctttgtg
tactgttggttggaacgaatgcctccaattccccccatcaagaatctagaggatctggtt
actgaataccaagggaacttttcggcctggagtggtgtgtctaaagggctgactgagagt
ctgcagccagactacagtgaacggttctgccacgtcagcgagattccccccaaaggaggg
gccctaggagaggggcctggaggttctccttgcagcctgcatagcccttactggcctccc
ccatgttattctctgaagccggaagcctga

DBGET integrated database retrieval system