KEGG   Mus musculus (mouse): 16187Help
Entry
16187             CDS       T01002                                 

Gene name
Il3, BPA, Csfmu, HCGF, Il-3, MCGF, PSF
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04664  Fc epsilon RI signaling pathway
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
mmu05310  Asthma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16187 (Il3)
   04151 PI3K-Akt signaling pathway
    16187 (Il3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16187 (Il3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    16187 (Il3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16187 (Il3)
   04664 Fc epsilon RI signaling pathway
    16187 (Il3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16187 (Il3)
   05202 Transcriptional misregulation in cancer
    16187 (Il3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    16187 (Il3)
  09163 Immune disease
   05310 Asthma
    16187 (Il3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16187 (Il3)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16187 (Il3)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16187 (Il3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Cytokines
   16187 (Il3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL3 DUF4635
Motif
Other DBs
NCBI-GeneID: 16187
NCBI-ProteinID: NP_034686
MGI: 96552
Ensembl: ENSMUSG00000018914
Vega: OTTMUSG00000005664
UniProt: P01586 Q5SX77
Structure
PDB: 

Position
11 B1.3; 11 32.13 cM
AA seq 166 aa AA seqDB search
MVLASSTTSIHTMLLLLLMLFHLGLQASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELK
TDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVF
IRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggttcttgccagctctaccaccagcatccacaccatgctgctcctgctcctgatgctc
ttccacctgggactccaagcttcaatcagtggccgggatacccaccgtttaaccagaacg
ttgaattgcagctctattgtcaaggagattatagggaagctcccagaacctgaactcaaa
actgatgatgaaggaccctctctgaggaataagagctttcggagagtaaacctgtccaaa
ttcgtggaaagccaaggagaagtggatcctgaggacagatacgttatcaagtccaatctt
cagaaacttaactgttgcctgcctacatctgcgaatgactctgcgctgccaggggtcttc
attcgagatctggatgactttcggaagaaactgagattctacatggtccaccttaacgat
ctggagacagtgctaacctctagaccacctcagcccgcatctggctccgtctctcctaac
cgtggaaccgtggaatgttaa

DBGET integrated database retrieval system