KEGG   Mus musculus (mouse): 16189Help
Entry
16189             CDS       T01002                                 

Gene name
Il4, BSF-1, Il-4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu05140  Leishmaniasis
mmu05200  Pathways in cancer
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease (IBD)
mmu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16189 (Il4)
   04151 PI3K-Akt signaling pathway
    16189 (Il4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16189 (Il4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16189 (Il4)
   04660 T cell receptor signaling pathway
    16189 (Il4)
   04658 Th1 and Th2 cell differentiation
    16189 (Il4)
   04659 Th17 cell differentiation
    16189 (Il4)
   04657 IL-17 signaling pathway
    16189 (Il4)
   04664 Fc epsilon RI signaling pathway
    16189 (Il4)
   04672 Intestinal immune network for IgA production
    16189 (Il4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16189 (Il4)
  09163 Immune disease
   05310 Asthma
    16189 (Il4)
   05320 Autoimmune thyroid disease
    16189 (Il4)
   05321 Inflammatory bowel disease (IBD)
    16189 (Il4)
   05330 Allograft rejection
    16189 (Il4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    16189 (Il4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16189 (Il4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16189 (Il4)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16189 (Il4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Cytokines
   16189 (Il4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL4
Motif
Other DBs
NCBI-GeneID: 16189
NCBI-ProteinID: NP_067258
MGI: 96556
Ensembl: ENSMUSG00000000869
Vega: OTTMUSG00000005642
UniProt: P07750
Position
11 B1.3; 11 31.97 cM
AA seq 140 aa AA seqDB search
MGLNPQLVVILLFFLECTRSHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATK
NTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESK
STSLKDFLESLKSIMQMDYS
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgggtctcaacccccagctagttgtcatcctgctcttctttctcgaatgtaccaggagc
catatccacggatgcgacaaaaatcacttgagagagatcatcggcattttgaacgaggtc
acaggagaagggacgccatgcacggagatggatgtgccaaacgtcctcacagcaacgaag
aacaccacagagagtgagctcgtctgtagggcttccaaggtgcttcgcatattttattta
aaacatgggaaaactccatgcttgaagaagaactctagtgttctcatggagctgcagaga
ctctttcgggcttttcgatgcctggattcatcgataagctgcaccatgaatgagtccaag
tccacatcactgaaagacttcctggaaagcctaaagagcatcatgcaaatggattactcg
tag

DBGET integrated database retrieval system