KEGG   Mus musculus (mouse): 16190
Entry
16190             CDS       T01002                                 

Gene name
Il4ra, CD124, I, Il4r
Definition
(RefSeq) interleukin 4 receptor, alpha
  KO
K05071  interleukin 4 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16190 (Il4ra)
   04151 PI3K-Akt signaling pathway
    16190 (Il4ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16190 (Il4ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16190 (Il4ra)
   04658 Th1 and Th2 cell differentiation
    16190 (Il4ra)
   04659 Th17 cell differentiation
    16190 (Il4ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16190 (Il4ra)
  09163 Immune disease
   05321 Inflammatory bowel disease
    16190 (Il4ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16190 (Il4ra)
   04090 CD molecules [BR:mmu04090]
    16190 (Il4ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16190 (Il4ra)
CD molecules [BR:mmu04090]
 Proteins
  16190 (Il4ra)
SSDB
Motif
Pfam: IL4Ra_N
Other DBs
NCBI-GeneID: 16190
NCBI-ProteinID: NP_001008700
MGI: 105367
Ensembl: ENSMUSG00000030748
Vega: OTTMUSG00000058201
UniProt: P16382 Q3U905
Position
7 F3; 7 68.94 cM
AA seq 810 aa
MGRLCTKFLTSVGCLILLLVTGSGSIKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCL
HYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSG
NVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTY
KEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQRLPLGVTI
SCLCIPLFCLFCYFSITKIKKIWWDQIPTPARSPLVAIIIQDAQVPLWDKQTRSQESTKY
PHWKTCLDKLLPCLLKHRVKKKTDFPKAAPTKSLQSPGKAGWCPMEVSRTVLWPENVSVS
VVRCMELFEAPVQNVEEEEDEIVKEDLSMSPENSGGCGFQESQADIMARLTENLFSDLLE
AENGGLGQSALAESCSPLPSGSGQASVSWACLPMGPSEEATCQVTEQPSHPGPLSGSPAQ
SAPTLACTQVPLVLADNPAYRSFSDCCSPAPNPGELAPEQQQADHLEEEEPPSPADPHSS
GPPMQPVESWEQILHMSVLQHGAAAGSTPAPAGGYQEFVQAVKQGAAQDPGVPGVRPSGD
PGYKAFSSLLSSNGIRGDTAAAGTDDGHGGYKPFQNPVPNQSPSSVPLFTFGLDTELSPS
PLNSDPPKSPPECLGLELGLKGGDWVKAPPPADQVPKPFGDDLGFGIVYSSLTCHLCGHL
KQHHSQEEGGQSPIVASPGCGCCYDDRSPSLGSLSGALESCPEGIPPEANLMSAPKTPSN
LSGEGKGPGHSPVPSQTTEVPVGALGIAVS
NT seq 2433 nt   +upstreamnt  +downstreamnt
atggggcggctttgcaccaagttcctgacctctgtgggctgtctgattttgctgttggtg
actggatctgggagcatcaaggtcctgggtgagcccacctgcttctctgactacatccgc
acttccacgtgtgagtggttcctggatagcgctgtggactgcagttctcagctctgccta
cactacaggctgatgttcttcgagttctctgaaaacctcacatgcatcccgaggaacagt
gccagcactgtgtgtgtgtgccacatggaaatgaataggccggtccaatcagacagatac
cagatggaactgtgggctgagcacagacagctgtggcagggctccttcagccccagtggt
aatgtgaagcccctagctccagacaacctcacactccacaccaatgtgtccgacgaatgg
ctgctgacctggaataacctgtacccatcgaacaacttactgtacaaagacctcatctcc
atggtcaacatctccagagaggacaaccctgcagaattcatagtctataatgtgacctac
aaggaacccaggctgagcttcccgatcaacatcctgatgtcaggggtctactatacggcg
cgtgtgagggtcagatcccagatactcactggcacctggagtgagtggagtcctagcatc
acgtggtacaaccacttccagctgcccctgatacagcgccttccactgggggtcaccatc
tcctgcctctgcatcccgttgttttgcctgttctgttacttcagcattaccaagattaag
aagatatggtgggaccagattcccaccccagcacgcagtcccttggtggccatcatcatt
caggatgcacaggtgcccctctgggataagcagacccgaagccaggagtcaaccaagtac
ccgcactggaaaacttgtctagacaagctgctgccttgcttgctgaagcacagagtaaag
aagaagacagacttcccgaaggctgccccaaccaagtctctccagagtcctggaaaggca
ggctggtgtcccatggaggtcagcaggaccgtcctctggccagagaatgttagtgtcagt
gtggtgcgctgtatggagctgtttgaggccccagtacagaatgtggaggaggaagaagat
gagatagtcaaagaggacctgagcatgtcacctgagaacagcggaggctgcggcttccag
gagagccaggcagacatcatggctcggctcactgagaacctgttttccgacttgttggag
gctgagaatgggggccttggccagtcagccttggcagagtcatgctcccctctgccttca
ggaagtgggcaggcttctgtatcctgggcctgcctccccatggggcccagtgaggaggcc
acatgccaggtcacagagcagccttcacacccaggccctctttcaggcagcccagcccag
agtgcacctactctggcttgcacgcaggtcccacttgtccttgcagacaatcctgcctac
cggagttttagtgactgctgtagcccggccccaaatcctggagagctggctccagagcag
cagcaggctgatcatctggaagaagaggagcctccaagcccggctgacccccattcttca
gggccaccaatgcagccagtggagagctgggagcagatccttcacatgagtgtcctgcag
catggggcagctgctggctccaccccagcccctgccggtggctaccaggagtttgtgcag
gcagtgaagcagggtgccgcccaggatcctggggtgcctggtgtcaggccttctggagac
cccggttacaaggccttctcgagcctgctcagcagcaatggcatccgcggggacacagca
gcagcggggactgacgatgggcatggaggctacaagcccttccagaatcctgttcctaac
cagtcccctagctccgtgcccttatttactttcggactagacacggagctgtcacccagt
cctctgaactcagacccacccaaaagccccccagaatgccttggtctggagctggggctc
aaaggaggtgactgggtgaaggcccctcctcctgcagatcaggtgcccaagccctttggg
gatgacctgggctttggtattgtgtactcgtccctcacttgccacttgtgtggccacctg
aagcaacaccacagccaggaggaaggtggccagagccccatcgttgctagccctggctgt
ggctgctgctacgatgacagatcaccatccctggggagcctctcgggggccttggaaagc
tgtcctgagggaataccaccagaagccaacctcatgtcagcacccaagacaccctcaaac
ttgtcaggggagggcaagggccctggtcactctcctgttcccagccagacgaccgaggtg
cctgtgggcgccctgggcattgctgtttcttag

DBGET integrated database retrieval system