KEGG   Mus musculus (mouse): 16191
Entry
16191             CDS       T01002                                 

Gene name
Il5, Il, Il-5
Definition
(RefSeq) interleukin 5
  KO
K05428  interleukin 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu05200  Pathways in cancer
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease
mmu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16191 (Il5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16191 (Il5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16191 (Il5)
   04660 T cell receptor signaling pathway
    16191 (Il5)
   04658 Th1 and Th2 cell differentiation
    16191 (Il5)
   04657 IL-17 signaling pathway
    16191 (Il5)
   04664 Fc epsilon RI signaling pathway
    16191 (Il5)
   04672 Intestinal immune network for IgA production
    16191 (Il5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16191 (Il5)
  09163 Immune disease
   05310 Asthma
    16191 (Il5)
   05320 Autoimmune thyroid disease
    16191 (Il5)
   05321 Inflammatory bowel disease
    16191 (Il5)
   05330 Allograft rejection
    16191 (Il5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16191 (Il5)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16191 (Il5)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16191 (Il5)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Cytokines
   16191 (Il5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 16191
NCBI-ProteinID: NP_034688
MGI: 96557
Ensembl: ENSMUSG00000036117
Vega: OTTMUSG00000005643
UniProt: P04401 Q5SV01
Structure
PDB: 
3B5K

Position
11 B1.3; 11 31.99 cM
AA seq 133 aa
MRRMLLHLSVLTLSCVWATAMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQ
LCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQE
FLGVMSTEWAMEG
NT seq 402 nt   +upstreamnt  +downstreamnt
atgagaaggatgcttctgcacttgagtgttctgactctcagctgtgtctgggccactgcc
atggagattcccatgagcacagtggtgaaagagaccttgacacagctgtccgctcaccga
gctctgttgacaagcaatgagacgatgaggcttcctgtccctactcataaaaatcaccag
ctatgcattggagaaatctttcaggggctagacatactgaagaatcaaactgtccgtggg
ggtactgtggaaatgctattccaaaacctgtcattaataaagaaatacattgaccgccaa
aaagagaagtgtggcgaggagagacggaggacgaggcagttcctggattacctgcaagag
ttccttggtgtgatgagtacagagtgggcaatggaaggctga

DBGET integrated database retrieval system