KEGG   Mus musculus (mouse): 16202
Entry
16202             CDS       T01002                                 

Gene name
Ilk, AA511515, ESTM2, ESTM24, ILK-1, ILK-2, p59ILK
Definition
(RefSeq) integrin linked kinase
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu05100  Bacterial invasion of epithelial cells
mmu05213  Endometrial cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16202 (Ilk)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    16202 (Ilk)
  09158 Development and regeneration
   04360 Axon guidance
    16202 (Ilk)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    16202 (Ilk)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    16202 (Ilk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16202 (Ilk)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    16202 (Ilk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     16202 (Ilk)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  MLK family
   16202 (Ilk)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    16202 (Ilk)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ank_4 Pkinase Ank_5 Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 16202
NCBI-ProteinID: NP_001155196
MGI: 1195267
Ensembl: ENSMUSG00000030890
Vega: OTTMUSG00000025598
UniProt: O55222
Position
7; 7 E3
AA seq 452 aa
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLAKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQAPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaacgcggtggcggtgcgcttgtggctg
gacaacacagagaacgacctcaatcagggggatgatcatggcttctcccccttgcactgg
gcctgccgagaaggccgctctgcggtggttgaaatgctgatcatgcgtggagcacggatt
aatgtgatgaatcgtggggatgatacccccctgcacctggcagctagtcatggacaccgt
gacattgtacagaagctgttgcaatacaaggctgacatcaatgcagtgaatgagcacggc
aatgtgccacttcactatgcatgtttctggggccaagaccaggtggcagaggacctggtg
gctaacggggctcttgtgagcatctgtaacaagtatggagagatgcctgtggacaaagcc
aaggcaccccttagagagcttctccgagaacgggcagagaaaatgggccagaatctcaac
cgtattccatacaaggacacattctggaaggggaccactcgcacaaggccccgaaatggg
accctgaacaaacactccggtattgacttcaaacagctcaactttctggcaaagctcaat
gagaatcattctggagagctttggaaaggccgctggcagggcaatgatattgttgtgaag
gtgctgaaggttcgagactggagtacaaggaaaagcagggacttcaatgaggaatgtccc
cggctcaggattttctcacaccctaacgtgctcccagtgctaggtgcttgccaggctccc
ccagccccccacccaaccctcatcacacactggatgccatatggatctctctacaatgtt
ctacatgaaggcaccaatttcgttgtggaccagagccaagctgtaaagtttgctttggac
atggcaagaggcatggcttttcttcacacactagagcctctcataccccggcatgcactc
aatagccgcagtgtaatgatcgatgaagatatgactgcccgaatcagcatggctgatgtt
aagttttctttccagtgccctgggcgcatgtatgcgcctgcctgggtggcccctgaagcc
ctgcagaagaagcctgaagacacaaacagacgctcagcagacatgtggagtttcgcggtg
cttctgtgggaactggtgacacgagaggtgccctttgctgacctctctaatatggagatt
gggatgaaggtggcactggaaggccttcggcctaccatcccaccaggtatttccccccat
gtgtgtaagctcatgaagatttgcatgaatgaagaccctgcaaagcgacccaagtttgac
atgattgtgcctatcttggagaagatgcaggacaagtag

DBGET integrated database retrieval system