KEGG   Mus musculus (mouse): 16326
Entry
16326             CDS       T01002                                 

Gene name
Inhbe
Definition
(RefSeq) inhibin beta-E
  KO
K22689  inhibin beta E chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    16326 (Inhbe)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16326 (Inhbe)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16326 (Inhbe)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16326 (Inhbe)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   16326 (Inhbe)
SSDB
Motif
Pfam: TGF_beta
Other DBs
NCBI-GeneID: 16326
NCBI-ProteinID: NP_032408
MGI: 109269
Ensembl: ENSMUSG00000047492
UniProt: O08717
Position
10 D3; 10 74.5 cM
AA seq 350 aa
MKLPKAQLWLILLWALVWVQSTRSACPSCGGPTLAPQGERALVLELAKQQILEGLHLTSR
PRITRPLPQAALTRALRRLQPKSMVPGNREKVISFATIIDKSTSTYRSMLTFQLSPLWSH
HLYHARLWLHVPPSFPGTLYLRIFRCGTTRCRGFRTFLAEHQTTSSGWHALTLPSSGLRS
EDSGVVKLQLEFRPLDLNSTAAGLPRLLLDTAGQQRPFLELKIRANEPGAGRARRRTPTC
EPETPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFS
LLKANNPWPAGSSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgaagcttccaaaagcccagctctggctaatactgctgtgggcattggtgtgggtgcag
agtacaagatctgcgtgcccgtcctgtgggggcccaacactggcaccccaaggagaacgc
gctctggtcctggagctagccaagcagcaaatcctggagggactgcacctaaccagccgt
cccagaataactcggcctctgccccaggcagcactgaccagagccctccggagactgcag
cccaagagcatggtccctggcaaccgagagaaagtcatcagctttgctaccatcatagac
aaatccacttcaacctaccgctccatgctcaccttccagctgtcccctctttggtcccac
cacctgtaccatgcccgcctctggctgcatgtgcctccctcttttccgggcactctgtac
ctgaggatcttccgttgcggcaccactaggtgccgaggattccgcaccttcctagctgag
caccaaaccacttcctctggctggcacgccctgactctgccctctagcggcttgcggagt
gaggactctggcgtcgtgaaactccaactggaatttagacccctggaccttaacagcacc
gctgcgggactgccacggctgctcttggacacagcgggacagcaacgtcccttcttggaa
cttaagatccgagctaatgaacctggagcaggtcgggccaggaggaggactcccacctgt
gagcctgagacccccttatgttgtaggcgagaccactatgtagacttccaggagctgggg
tggcgggattggatcctgcagccggagggataccagctgaattactgcagtgggcagtgc
ccgccccacctggctggcagtcctggcattgctgcctccttccattctgccgtctttagc
ctcctcaaagccaacaacccttggcctgcgggttcttcctgctgtgtccccactgcacga
aggcctctctctctcctctaccttgaccataatggcaatgtggtcaagaccgatgtgcca
gacatggtagtagaggcctgtggctgcagctag

DBGET integrated database retrieval system