KEGG   Mus musculus (mouse): 16329
Entry
16329             CDS       T01002                                 

Gene name
Inpp1, 2300002C06Rik, AV137389
Definition
(RefSeq) inositol polyphosphate-1-phosphatase
  KO
K01107  inositol polyphosphate 1-phosphatase [EC:3.1.3.57]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
Module
mmu_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    16329 (Inpp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    16329 (Inpp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.57  inositol-1,4-bisphosphate 1-phosphatase
     16329 (Inpp1)
SSDB
Motif
Pfam: Inositol_P
Other DBs
NCBI-GeneID: 16329
NCBI-ProteinID: NP_032410
MGI: 104848
Ensembl: ENSMUSG00000026102
Vega: OTTMUSG00000026596
UniProt: P49442
Position
1 C1.1; 1 26.99 cM
AA seq 396 aa
MSDILLELLCVSEKAANIARACRQQETLFQLLIEEKKGAEKNKKFAADFKTLADVLVQEV
IKQNMENKFPGLGKKVFGEESNEFTNDLGEKITVELQSTEEETAELLSKVLNGNMPASEA
LAQVVHEDVDLTDPTLESLDISIPHESLGIWVDPIDSTYQYIKGSANVKSNQGIFPSGLQ
CVTILIGVYDLQTGLPLMGVINQPFASQNLTTLRWKGQCYWGLSYMGTNIHSLQLAISKS
DSETQTENSDREFSSPFSAVISTSEKDTIKAALSRVCGGSVFPAAGAGYKSLCVIQGLAD
IYIFSEDTTYKWDSCAAHAILRAMGGGIVDMKECLERSPDTGLDLPQLLYHVENKGASGV
ELWANKGGLIAYRSRNRLDTFLSRLIQNLGPVKTQA
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgtcagacatcctcctggagctgctctgtgtctccgagaaggctgctaacatcgccagg
gcgtgcaggcagcaggagaccctcttccagctgctcattgaggagaagaaaggtgcagag
aagaacaagaagtttgctgcagatttcaagaccctggcggatgtgctggtgcaggaagtt
ataaaacagaacatggaaaacaagtttccaggcttggggaaaaaagtttttggagaagaa
tccaatgagtttacaaatgatttgggggaaaagatcacagtggagctgcagtccacggag
gaggagacggcagagcttctcagcaaggtccttaacggcaacatgccggcatcggaagcg
ctggctcaggtggttcatgaggacgtggacttaactgatcccacgctggagtccctggac
atcagcatccctcacgagagtcttgggatttgggtggatcccattgattcaacctatcag
tatattaaaggttctgccaatgttaaatccaaccaaggaattttccccagcggacttcag
tgtgtaaccattttaattggcgtgtatgacctacagacaggcctgcccctaatgggagtc
atcaatcagccttttgcgtcccaaaacctaactactttaaggtggaagggacagtgctac
tggggcctttcgtacatggggaccaacatccattccctgcagctcgccatctctaaaagc
gacagtgaaacccagactgaaaactcggacagagagttctccagccccttttctgcagtc
atcagtaccagcgaaaaagacaccatcaaagctgctctttcgcgcgtgtgcggaggtagc
gtcttccccgcggcaggggctggctacaagagcctctgtgtaatccagggcttggctgac
atttacatcttctcagaggacaccacgtacaagtgggactcctgtgccgcccacgccatt
ctgagggccatgggtgggggcattgtagacatgaaagagtgcttagagagaagtccagac
acggggttggatttgccacagctgctgtatcatgtggaaaataaaggtgcttctggggtg
gaactctgggccaacaagggagggctgatagcttacaggtccaggaatcggctggacacc
ttcctgagccgcctcatccaaaacctcgggcctgtaaagacacaagcataa

DBGET integrated database retrieval system