KEGG   Mus musculus (mouse): 16331
Entry
16331             CDS       T01002                                 

Gene name
Inpp5d, S, SH, SHI, SHIP, SHIP-1, SHIP1, SIP-145, p150Ship, s-, s-SHIP
Definition
(RefSeq) inositol polyphosphate-5-phosphatase D
  KO
K03084  phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 [EC:3.1.3.86]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    16331 (Inpp5d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    16331 (Inpp5d)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    16331 (Inpp5d)
   04664 Fc epsilon RI signaling pathway
    16331 (Inpp5d)
   04666 Fc gamma R-mediated phagocytosis
    16331 (Inpp5d)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.86  phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase
     16331 (Inpp5d)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    16331 (Inpp5d)
SSDB
Motif
Pfam: SH2 Exo_endo_phos
Other DBs
NCBI-GeneID: 16331
NCBI-ProteinID: NP_034696
MGI: 107357
Ensembl: ENSMUSG00000026288
Vega: OTTMUSG00000035865
UniProt: Q9ES52
Structure
PDB: 
6DLG

Position
1 D; 1 44.44 cM
AA seq 1191 aa
MPAMVPGWNHGNITRSKAEELLSRAGKDGSFLVRASESIPRAYALCVLFRNCVYTYRILP
NEDDKFTVQASEGVPMRFFTKLDQLIDFYKKENMGLVTHLQYPVPLEEEDAIDEAEEDTV
ESVMSPPELPPRNIPMSAGPSEAKDLPLATENPRAPEVTRLSLSETLFQRLQSMDTSGLP
EEHLKAIQDYLSTQLLLDSDFLKTGSSNLPHLKKLMSLLCKELHGEVIRTLPSLESLQRL
FDQQLSPGLRPRPQVPGEASPITMVAKLSQLTSLLSSIEDKVKSLLHEGSESTNRRSLIP
PVTFEVKSESLGIPQKMHLKVDVESGKLIVKKSKDGSEDKFYSHKKILQLIKSQKFLNKL
VILVETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAP
PPKKITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLGEKEWLELLRHSLQEVTSMTF
KTVAIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGF
VNSHLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWLGDLNYRVELPTW
EAEAIIQKIKQQQYSDLLAHDQLLLERKDQKVFLHFEEEEITFAPTYRFERLTRDKYAYT
KQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFV
SKNGPGTVDSQGQIEFLACYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELV
VRFGETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLETTEAQHPIYTPL
THHGEMTGHFRGEIKLQTSQGKMREKLYDFVKTERDESSGMKCLKNLTSHDPMRQWEPSG
RVPACGVSSLNEMINPNYIGMGPFGQPLHGKSTLSPDQQLTAWSYDQLPKDSSLGPGRGE
GPPTPPSQPPLSPKKFSSSTANRGPCPRVQEARPGDLGKVEALLQEDLLLTKPEMFENPL
YGSVSSFPKLVPRKEQESPKMLRKEPPPCPDPGISSPSIVLPKAQEVESVKGTSKQAPVP
VLGPTPRIRSFTCSSSAEGRMTSGDKSQGKPKASASSQAPVPVKRPVKPSRSEMSQQTTP
IPAPRPPLPVKSPAVLQLQHSKGRDYRDNTELPHHGKHRQEEGLLGRTAMQ
NT seq 3576 nt   +upstreamnt  +downstreamnt
atgcctgccatggtccctgggtggaaccatggcaacatcacccgctccaaggcagaggag
ctactttccagagccggcaaggacgggagcttccttgtgcgtgccagcgagtccatcccc
cgggcctacgcactctgcgtgctgttccggaattgtgtttacacttacaggattctgccc
aatgaggacgataaattcactgttcaggcatccgaaggtgtccccatgaggttcttcacg
aagctggaccagctcatcgacttttacaagaaggaaaacatggggctggtgacccacctg
cagtaccccgtgcccctggaggaggaggatgctattgatgaggctgaggaggacactgta
gaaagtgtcatgtcaccacctgagctgcctcccagaaacattcctatgtctgccgggccc
agcgaggccaaggaccttcctcttgcaacagagaacccccgagcccctgaggtcacccgg
ctgagtctctccgagacactgtttcagcgtctacagagcatggataccagtgggcttccc
gaggagcacctgaaagccatccaggattatctgagcactcagctcctcctggattccgac
tttttgaagacgggctccagcaacctccctcacctgaagaagctgatgtcactgctctgc
aaggagctccatggggaagtcatcaggactctgccatccctggagtctctgcagaggttg
tttgaccaacagctctccccaggccttcgcccacgacctcaggtgcccggagaggccagt
cccatcaccatggttgccaaactcagccaattgacaagtctgctgtcttccattgaagat
aaggtcaagtccttgctgcacgagggctcagaatctaccaacaggcgttcccttatccct
ccggtcacctttgaggtgaagtcagagtccctgggcattcctcagaaaatgcatctcaaa
gtggacgttgagtctgggaaactgatcgttaagaagtccaaggatggttctgaggacaag
ttctacagccacaaaaaaatcctgcagctcattaagtcccagaagtttctaaacaagttg
gtgattttggtggagacggagaaggagaaaatcctgaggaaggaatatgtttttgctgac
tctaagaaaagagaaggcttctgtcaactcctgcagcagatgaagaacaagcattcggag
cagccagagcctgacatgatcaccatcttcattggcacttggaacatgggtaatgcaccc
cctcccaagaagatcacgtcctggtttctctccaaggggcagggaaagacacgggacgac
tctgctgactacatcccccatgacatctatgtgattggcacccaggaggatccccttgga
gagaaggagtggctggagctactcaggcactccctgcaagaagtcaccagcatgacattt
aaaacagttgccatccacaccctctggaacattcgcatagtggtgcttgccaagccagag
catgagaatcggatcagccatatctgcactgacaacgtgaagacaggcatcgccaacacc
ctgggaaacaagggagcagtgggagtgtccttcatgttcaatggaacctccttggggttc
gtcaacagccacttgacttctggaagtgaaaaaaagctcaggagaaatcaaaactatatg
aacatcctgcggttcctggccctgggagacaagaagctaagcccatttaacatcacccac
cgcttcacccacctcttctggcttggggatctcaactaccgcgtggagctgcccacttgg
gaggcagaggccatcatccagaagatcaagcaacagcagtattcagaccttctggcccac
gaccaactgctcctggagaggaaggaccagaaggtcttcctgcactttgaggaggaagag
atcaccttcgcccccacctatcgatttgaaagactgacccgggacaagtatgcatacacg
aagcagaaagcaacagggatgaagtacaacttgccgtcctggtgcgaccgagtcctctgg
aagtcttacccgctggtgcatgtggtctgtcagtcctatggcagtaccagtgacatcatg
acgagtgaccacagccctgtctttgccacgtttgaagcaggagtcacatctcaattcgtc
tccaagaatggtcctggcactgtagatagccaagggcagatcgagtttcttgcatgctac
gccacactgaagaccaagtcccagactaagttctacttggagttccactcaagctgctta
gagagttttgtcaagagtcaggaaggagagaatgaagagggaagtgaaggagagctggtg
gtacggtttggagagactcttcccaagctaaagcccattatctctgaccccgagtactta
ctggaccagcatatcctgatcagcattaaatcctctgacagtgacgagtcctatggtgaa
ggctgcattgcccttcgcttggagaccacagaggctcagcatcctatctacacgcctctc
acccaccatggggagatgactggccacttcaggggagagattaagctgcagacctcccag
ggcaagatgagggagaagctctatgactttgtgaagacagagcgggatgaatccagtgga
atgaaatgcttgaagaacctcaccagccatgaccctatgaggcaatgggagccttctggc
agggtccctgcatgtggtgtctccagcctcaatgagatgatcaatccaaactacattggt
atggggccttttggacagcccctgcatgggaaatcaaccctgtccccagatcagcaactc
acagcttggagttatgaccagctacccaaagactcctccctggggcctgggaggggggag
ggtcctccaacccctccctcccaaccacctctgtcgccaaagaagttttcatcttccaca
gccaaccgaggtccctgccccagggtgcaagaggcaagacctggggatctgggaaaggtg
gaagctctgctccaggaggacctgctgctgacgaagcccgagatgtttgagaacccactg
tatggatccgtgagttccttccctaagctggtgcccaggaaagagcaggagtctcccaag
atgctgcggaaggagcccccgccctgtccagacccaggaatctcatcacccagcatcgtg
ctccccaaagcccaagaggtggagagtgtcaaggggacaagcaaacaggcccctgtgcct
gtccttggccccacaccccggatccgctcctttacctgttcttcttctgctgagggcaga
atgaccagtggggacaagagccaagggaagcccaaggcctcagccagttcccaagcccca
gtgccagtcaagaggcctgtcaagccttccaggtcagaaatgagccagcagacaacaccc
atcccagctccacggccacccctgccagtcaagagtcctgctgtcctgcagctgcaacat
tccaaaggcagagactaccgtgacaacacagaactcccccaccatggcaagcaccgccaa
gaggaggggctgcttggcaggactgccatgcagtga

KEGG   Mus musculus (mouse): 16332
Entry
16332             CDS       T01002                                 

Gene name
Inppl1, 51C, SH, SHIP2
Definition
(RefSeq) inositol polyphosphate phosphatase-like 1
  KO
K15909  phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2 [EC:3.1.3.86]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04662  B cell receptor signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    16332 (Inppl1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    16332 (Inppl1)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    16332 (Inppl1)
   04666 Fc gamma R-mediated phagocytosis
    16332 (Inppl1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    16332 (Inppl1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.86  phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase
     16332 (Inppl1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Inositol 5-phosphatases
    16332 (Inppl1)
SSDB
Motif
Pfam: SH2 Exo_endo_phos SAM_2 SAM_1
Other DBs
NCBI-GeneID: 16332
NCBI-ProteinID: NP_001116211
MGI: 1333787
Ensembl: ENSMUSG00000032737
Vega: OTTMUSG00000046069
UniProt: Q6P549
Position
7; 7 E2
AA seq 1257 aa
MASVCGTPSPGGALGSPAPAWYHRDLSRAAAEELLARAGRDGSFLVRDSESVAGAFALCV
LYQKHVHTYRILPDGEDFLAVQTSQGVPVRRFQTLGELIGLYAQPNQGLVCALLLPVEGE
REPDPPDDRDASDVEDEKPPLPPRSGSTSISAPVGPSSPLPTPETPTTPAAESTPNGLST
VSHEYLKGSYGLDLEAVRGGASNLPHLTRTLVTSCRRLHSEVDKVLSGLEILSKVFDQQS
SPMVTRLLQQQSLPQTGEQELESLVLKLSVLKDFLSGIQKKALKALQDMSSTAPPAPLQP
SIRKAKTIPVQAFEVKLDVTLGDLTKIGKSQKFTLSVDVEGGRLVLLRRQRDSQEDWTTF
THDRIRQLIKSQRVQNKLGVVFEKEKDRTQRKDFIFVSARKREAFCQLLQLMKNRHSKQD
EPDMISVFIGTWNMGSVPPPKNVTSWFTSKGLGKALDEVTVTIPHDIYVFGTQENSVGDR
EWLDLLRGGLKELTDLDYRPIAMQSLWNIKVAVLVKPEHENRISHVSTSSVKTGIANTLG
NKGAVGVSFMFNGTSFGFVNCHLTSGNEKTTRRNQNYLDILRLLSLGDRQLSAFDISLRF
THLFWFGDLNYRLDMDIQEILNYISRREFEPLLRVDQLNLEREKHKVFLRFSEEEISFPP
TYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPETHIICNSYGCTDDIVTSDHS
PVFGTFEVGVTSQFISKKGLSKTSDQAYIEFESIEAIVKTASRTKFFIEFYSTCLEEYKK
SFENDAQSSDNINFLKVQWSSRQLPTLKPILADIEYLQDQHLLLTVKSMDGYESYGECVV
ALKSMIGSTAQQFLTFLSHRGEETGNIRGSMKVRVPTERLGTRERLYEWISIDKDDTGAK
SKVPSVSRGSQEHRSGSRKPASTETSCPLSKLFEEPEKPPPTGRPPAPPRAVPREEPLNP
RLKSEGTSEQEGVAAPPPKNSFNNPAYYVLEGVPHQLLPLEPPSLARAPLPPATKNKVAI
TVPAPQLGRHRTPRVGEGSSSDEDSGGTLPPPDFPPPPLPDSAIFLPPNLDPLSMPVVRG
RSGGEARGPPPPKAHPRPPLPPGTSPASTFLGEVASGDDRSCSVLQMAKTLSEVDYAPGP
GRSALLPNPLELQPPRGPSDYGRPLSFPPPRIRESIQEDLAEEAPCPQGGRASGLGEAGM
GAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
NT seq 3774 nt   +upstreamnt  +downstreamnt
atggcctcagtgtgtgggacaccgagtcccgggggtgcgctaggcagcccggccccagcc
tggtatcaccgtgacctgagccgcgctgctgcggaggagctcctggctcgggcgggccgc
gatggcagcttcctggtgcgagatagcgagagcgtggcgggggccttcgcactctgcgtc
ctgtatcaaaagcacgtgcacacctaccgcattctgccagatggagaggatttcctggct
gtgcagacctcacagggtgttcctgtgcgtcgcttccagaccctgggtgagcttataggc
ctatatgcccagcccaaccagggtcttgtttgtgccctgctgctgcctgtagagggggag
agagagccagacccaccagatgaccgagatgcctcagatgtggaggacgagaagccccca
ctacccccgcgctctggctctaccagcatttctgcccctgtggggcccagcagccccctg
ccgactcccgagactcccacaactccagcagctgagagcactcctaatggactcagcact
gtgtcacatgagtatctgaagggcagctacgggctggacctggaggctgtacgaggtgga
gccagcaacttgccacatctcaccagaacccttgtcacctcgtgccgaaggctacacagc
gaggtggacaaggtcctgtcaggcttggagatcctgtcgaaggtgtttgaccagcagagc
tcgcccatggtgacccgccttttacagcagcagagcttaccacagactggagagcaggag
ctggagagccttgtgctgaagctatctgtgttaaaggacttcctgtcaggcatccagaag
aaggccctaaaggcactgcaggacatgagctccacagcgcctccggctccattgcagccc
tccatacgcaaggccaagaccatccccgtgcaggcctttgaggtgaagctggatgtaaca
ctgggtgacctgaccaagattgggaagtcccagaagttcacgctgagtgtggatgtcgag
ggtgggaggctggttctgctgaggagacagcgtgactcccaggaggactggacaaccttc
acacatgaccggatccggcagctcattaaatcccagcgtgtgcagaacaagctgggtgtt
gtgtttgaaaaggagaaagatcggacccagcgcaaggacttcatctttgtcagtgcccgg
aaacgagaagccttctgccagctcctgcagctcatgaagaacaggcactccaagcaggac
gagcccgacatgatctctgtcttcataggcacctggaacatgggaagtgtaccaccaccc
aaaaacgtgacatcttggttcacatcaaagggactggggaaagctctggatgaggtcaca
gtgactataccccacgatatctatgtctttgggactcaggagaactcagtgggtgacaga
gagtggctggatctgctgcgtgggggcctcaaggagcttacagatctggattaccgtccg
attgctatgcagtcactatggaacatcaaggtggctgtgttggtcaagccagaacatgag
aatcgcatcagccacgtcagtacgtccagtgtgaagactggtatcgccaacaccctgggg
aacaagggagccgtgggtgtgtccttcatgttcaatggcacctcatttggcttcgtgaat
tgccatctcacctcagggaatgagaagactactcggcggaaccagaattatctggacatt
ctgcgtctcctctcgttgggtgatcggcagctcagtgcctttgacatctctttgcggttc
actcatctcttctggtttggggaccttaactaccgcttagacatggatatccaggagatc
ctgaactacattagtaggagagagtttgagcctctgctcagggtggaccagctcaacctg
gagcgggagaagcataaggtcttccttcgatttagtgaggaggagatatctttcccaccc
acctaccgctacgagcggggttcccgggacacatacgcttggcacaagcagaagccaact
ggggtccggaccaatgtgccttcgtggtgtgaccggattctatggaaatcctatcctgaa
acccacatcatctgcaattcctatggttgcactgatgacattgttaccagtgaccattct
cctgtgtttgggacatttgaggttggagttacttcccagttcatctccaagaaaggtctc
tctaagacctcagatcaagcctacattgagtttgagagtatcgaagccattgtgaagaca
gccagccgcaccaagttcttcattgagttctattctacctgcttggaagagtataagaag
agcttcgagaatgatgctcagagcagcgacaacatcaatttcctcaaggtgcagtggtcc
tcccgccagctacccacgctcaagccaattctggctgacattgagtacctgcaggatcag
catctcctgctcacagtcaagtccatggatggctacgaatcatatggggagtgtgtggtt
gcactcaagtccatgattggcagcacagcccagcagttcctgaccttcttgtcccaccgt
ggagaggagacaggcaacatccgtggctccatgaaggtgcgggtgcccacagagcgcctg
ggcacccgtgagcggctctatgaatggattagcattgataaggatgacacaggagccaaa
agcaaggttccttcagtgtcaagaggcagccaggagcacagatctgggagccgcaagcca
gcttccacagagacctcctgtccactgtccaagttgtttgaagagcctgaaaagccacca
ccgactggcagacccccggccccaccacgggcagttcctagggaggagcccttgaaccca
aggctgaagtcagaagggacatctgagcaggaaggagtagcagcccccccacccaagaac
agcttcaataaccctgcctactacgtccttgaaggggtcccacatcagctgctgcccctg
gagccaccctcacttgccagggcccctctcccacctgccaccaagaacaaagtggccatc
acagtgcctgctcctcagcttgggcgccaccggacccctcgtgtgggggagggaagctca
tcagatgaggactctgggggcacgctgcctcctccagatttcccacctccaccactgcca
gactcagccatcttcctgccccctaacctggatcctttgtcaatgccagtggtcaggggc
cgaagtgggggtgaggcccgtggcccaccacctcccaaggcccatccaagaccaccacta
ccgccaggcacctcacctgccagtacttttttgggagaggtcgcaagtggggatgaccgg
tcttgttcggtactgcaaatggccaaaacactcagtgaggtagattatgctccagggcct
ggacgctcagcactcctccccaaccccttggaattgcagcctccccgagggccctcggac
tatggccggcccctcagcttccctccaccccgcatccgggagagcatccaagaagacttg
gcagaggaggctccgtgcccgcagggcgggcgggccagcgggctgggagaggcgggcatg
ggtgcctggctgcgggccatcggcttggagcgctatgaggagggcctggtgcacaatggc
tgggacgacctggagtttctcagtgacatcactgaggaagaccttgaggaagctggggtg
caggatcctgctcacaagcgccttcttctggacaccttgcagctcagcaaatga

DBGET integrated database retrieval system