KEGG   Mus musculus (mouse): 16334
Entry
16334             CDS       T01002                                 

Gene name
Ins2, AA986540, In, Ins-2, InsII, Mod, Mody, Mody4
Definition
(RefSeq) insulin II
  KO
K04526  insulin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04911  Insulin secretion
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04940  Type I diabetes mellitus
mmu04950  Maturity onset diabetes of the young
mmu04960  Aldosterone-regulated sodium reabsorption
mmu05010  Alzheimer disease
mmu05215  Prostate cancer
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16334 (Ins2)
   04014 Ras signaling pathway
    16334 (Ins2)
   04015 Rap1 signaling pathway
    16334 (Ins2)
   04066 HIF-1 signaling pathway
    16334 (Ins2)
   04068 FoxO signaling pathway
    16334 (Ins2)
   04072 Phospholipase D signaling pathway
    16334 (Ins2)
   04022 cGMP-PKG signaling pathway
    16334 (Ins2)
   04151 PI3K-Akt signaling pathway
    16334 (Ins2)
   04152 AMPK signaling pathway
    16334 (Ins2)
   04150 mTOR signaling pathway
    16334 (Ins2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    16334 (Ins2)
  09143 Cell growth and death
   04114 Oocyte meiosis
    16334 (Ins2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16334 (Ins2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    16334 (Ins2)
   04910 Insulin signaling pathway
    16334 (Ins2)
   04923 Regulation of lipolysis in adipocytes
    16334 (Ins2)
   04913 Ovarian steroidogenesis
    16334 (Ins2)
   04914 Progesterone-mediated oocyte maturation
    16334 (Ins2)
   04917 Prolactin signaling pathway
    16334 (Ins2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    16334 (Ins2)
  09149 Aging
   04211 Longevity regulating pathway
    16334 (Ins2)
   04213 Longevity regulating pathway - multiple species
    16334 (Ins2)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    16334 (Ins2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16334 (Ins2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    16334 (Ins2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    16334 (Ins2)
   04940 Type I diabetes mellitus
    16334 (Ins2)
   04950 Maturity onset diabetes of the young
    16334 (Ins2)
   04932 Non-alcoholic fatty liver disease
    16334 (Ins2)
   04931 Insulin resistance
    16334 (Ins2)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 16334
NCBI-ProteinID: NP_001172012
MGI: 96573
Ensembl: ENSMUSG00000000215
Vega: OTTMUSG00000018794
UniProt: P01326 Q5EEX1
Position
7 F5; 7 88.0 cM
AA seq 110 aa
MALWMRFLPLLALLFLWESHPTQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVED
PQVAQLELGGGPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN
NT seq 333 nt   +upstreamnt  +downstreamnt
atggccctgtggatgcgcttcctgcccctgctggccctgctcttcctctgggagtcccac
cccacccaggcttttgtcaagcagcacctttgtggttcccacctggtggaggctctctac
ctggtgtgtggggagcgtggcttcttctacacacccatgtcccgccgtgaagtggaggac
ccacaagtggcacaactggagctgggtggaggcccgggagcaggtgaccttcagaccttg
gcactggaggtggcccagcagaagcgtggcattgtagatcagtgctgcaccagcatctgc
tccctctaccagctggagaactactgcaactag

DBGET integrated database retrieval system